MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint blasche-2012-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lumier luminescence based mammalian interactome mapping lumier predetermined predetermined participant predetermined Blasche S., Mörtl M., Steuber H., Siszler G., Nisa S., Schwarz F., Lavrik I., Gronewold TM., Maskos K., Donnenberg MS., Ullmann D., Uetz P., Kögl M. uetz@vcu.edu PloS one 2012 Only protein-protein interactions imex curation imex curation blasche-2012-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling predetermined predetermined participant predetermined Blasche S., Mörtl M., Steuber H., Siszler G., Nisa S., Schwarz F., Lavrik I., Gronewold TM., Maskos K., Donnenberg MS., Ullmann D., Uetz P., Kögl M. uetz@vcu.edu Human libraries used in this study are the MGC ORF collection and the universal human cDNA library (Clontech 638874). PloS one 2012 Only protein-protein interactions imex curation imex curation blasche-2012-3 in vitro In vitro force measurement force measurement intermolecular force predetermined predetermined participant predetermined Blasche S., Mörtl M., Steuber H., Siszler G., Nisa S., Schwarz F., Lavrik I., Gronewold TM., Maskos K., Donnenberg MS., Ullmann D., Uetz P., Kögl M. uetz@vcu.edu PloS one 2012 Only protein-protein interactions imex curation imex curation blasche-2012-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Blasche S., Mörtl M., Steuber H., Siszler G., Nisa S., Schwarz F., Lavrik I., Gronewold TM., Maskos K., Donnenberg MS., Ullmann D., Uetz P., Kögl M. uetz@vcu.edu PloS one 2012 Only protein-protein interactions imex curation imex curation nlef_eco57 Effector protein NleF nleF Non-LEE-encoded type III effector F Z6020.1 ECs1815 protein protein eco57 Escherichia coli O157:H7 MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNNELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSLKVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLTYNKGSLQCG casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD casp4_human Caspase-4 ICH2 CASP4 Protease TX ICE(rel)-II ICE and Ced-3 homolog 2 Mih1 protein protein human Homo sapiens Human MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS nlef-casp8-2 3731795 N/A 3731799 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q8XAL7:p.Gly189del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Leu186Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Gln187Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Cys188Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Gly189Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n-n luciferase tag luciferase tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8XAL7:p.Leu186_Gly189del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false NleF +18 (random amino acids) was generated by removal of the native stop codon. N/A 3731800 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-n protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false fig. 1a, 6b sf2 nlef-casp4-2 3731795 N/A 3731799 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q8XAL7:p.Gly189del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Leu186Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Gln187Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Cys188Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n-n luciferase tag luciferase tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8XAL7:p.Gly189Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Leu186_Gly189del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false NleF +18 (random amino acids) was generated by removal of the native stop codon. N/A 3731801 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-n protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false fig. 1a, 6a sf2 nlef-casp9-2 3731795 N/A 3731799 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q8XAL7:p.Gly189del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Leu186Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Gln187Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Cys188Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false n-n luciferase tag luciferase tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8XAL7:p.Gly189Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q8XAL7:p.Leu186_Gly189del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false NleF +18 (random amino acids) was generated by removal of the native stop codon. N/A 3731802 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-n protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false fig. 1a, 6a sf2 1-155 3731796 N/A 3731799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3731802 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false text In a systematic effort to elucidate the cellular targets of EHEC effector proteins, we identified caspase-9 as a binding partner of NleF. Caspase-9 was the predominant hit identified in screens of NleF against amino- and carboxy-terminally tagged yeast two-hybrid libraries 1-156 3731797 N/A 3731799 unspecified role unspecified role prey prey purified purified N/A 3731802 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 3731797 fig. 1c The affinity constant (Kd) of NleF binding to immobilized caspase-9 as measured by surface acoustic wave (SAW) technology is ∼39 nM. Binding kinetic and affinity was analysed on sam®5 BLUE and sam®5 GREEN instruments (SAW Instruments GmbH, Bonn, Germany). Both instruments use the "surface acoustic wave"-principle for label-free analysis of molecular binding in a flow-through system as described in Perpeet et al. (2006) 1-157 3731798 N/A 3731802 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3731799 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false st2 fig.4