IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ skjoedt-2012-4 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Skjoedt MO., Roversi P., Hummelshøj T., Palarasah Y., Rosbjerg A., Johnson S., Lea SM., Garred P. moskjoedt@gmail.com The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation skjoedt-2012-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Skjoedt MO., Roversi P., Hummelshøj T., Palarasah Y., Rosbjerg A., Johnson S., Lea SM., Garred P. moskjoedt@gmail.com The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation skjoedt-2012-1 crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Skjoedt MO., Roversi P., Hummelshøj T., Palarasah Y., Rosbjerg A., Johnson S., Lea SM., Garred P. moskjoedt@gmail.com The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation skjoedt-2012-2 crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) light scattering light scattering predetermined predetermined participant predetermined Skjoedt MO., Roversi P., Hummelshøj T., Palarasah Y., Rosbjerg A., Johnson S., Lea SM., Garred P. moskjoedt@gmail.com The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA fcn3_human Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR p48740-3 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKSEQVTE p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI alb-fcn3-4 3961340 N/A 3961344 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961347 inhibitor inhibitor prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 alb-fcn3-5 3961340 N/A 3961344 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 alb-fcn3-6 3961340 N/A 3961348 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961347 inhibitor inhibitor prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 alb-fcn3-7 3961340 N/A 3961348 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 alb-fcn3-8 3961340 N/A 3961349 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961347 inhibitor inhibitor prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 alb-fcn3-9 3961340 N/A 3961349 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961345 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum N/A 3961346 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 5 mbl2-masp1-6 3961341 N/A 3961350 unspecified role unspecified role bait bait partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961347 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 3961341 4 fcn3-masp1-3 3961341 N/A 3961346 unspecified role unspecified role bait bait partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961347 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 3961341 4 fcn3-masp1-4 3961341 N/A 3961346 unspecified role unspecified role bait bait partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961348 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 3961341 4 mbl2-masp1-7 3961341 N/A 3961350 unspecified role unspecified role bait bait partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961348 unspecified role unspecified role prey prey partially purified partially purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false 3961341 4 masp1-12 3961342 N/A 3961347 unspecified role unspecified role neutral component neutral component partially purified partially purified Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 masp1-14 3961343 N/A 3961347 unspecified role unspecified role neutral component neutral component partially purified partially purified Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 2 EDTA - CHEBI:42191