IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ diether-2019-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr structure determination identification by structure determination identification by structure determination structure determination Diether M., Nikolaev Y., Allain FH., Sauer U. The authors used a Relaxation Factor cut-off of 0.1805 to define bona-fide protein-metabolite interactions. The cut-off was defined by using a set of reference known interactions and selecting the value that yielded a false-positive rate of 5%. Pools of 12-15 metabolites were tested against each purified protein and the identity of the bound ones was ascertained by solving the structure of the metabolite-protein complex. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation diether-2019-2 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. Enzymatic in vitro assays for Zwf were performed by measuring the formation of NADPH photometrically at 340 nm. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation diether-2019-3 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. Transference of acetyl group from acetyl phosphate to Coenzyme A was monitored via FIA TOF‐MS. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation diether-2019-4 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. This assay monitored the cleavage of fructose-6-phosphate into dihydroxyacetone and D-glyceraldehyde-3-phosphate. Reactants concentrations were measured by FIA TOF‐MS. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation 3phosphodglyceric acid 3-phospho-D-glyceric acid (2R)-2-hydroxy-3-(phosphonooxy)propanoic acid 3-phospho-D-glycerate 3-Phospho-D-glycerate 3-Phosphoglycerate D-glycerate 3-phosphate D-Glycerate 3-phosphate 3-Phospho-(R)-glycerate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) acea_ecoli Isocitrate lyase aceA icl b4015 JW3975 Isocitrase Isocitratase protein protein ecoli Escherichia coli (strain K12) MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTSSVTALTGSTEESQF alf_ecoli Fructose-bisphosphate aldolase class 2 fbaA fba fda Fructose-1,6-bisphosphate aldolase Fructose-bisphosphate aldolase class II b2925 JW2892 protein protein ecoli Escherichia coli (strain K12) MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL g3p1_ecoli Glyceraldehyde-3-phosphate dehydrogenase A gapA NAD-dependent glyceraldehyde-3-phosphate dehydrogenase JW1768 b1779 protein protein ecoli Escherichia coli (strain K12) MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSNKVLDLIAHISK 6pgd_ecoli 6-phosphogluconate dehydrogenase, decarboxylating gnd b2029 JW2011 protein protein ecoli Escherichia coli (strain K12) MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD mao1_ecoli NAD-dependent malic enzyme sfcA JW5238 b1479 maeA protein protein ecoli Escherichia coli (strain K12) MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERAWIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYRRSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYTACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPDVLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRENLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPTSRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGASRITDEMLMSASETLAQYSPLVLNGEGMVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTSAEALQQAIDDNFWQAEYRDYRRTSI pcka_ecoli Phosphoenolpyruvate carboxykinase (ATP) pckA pck b3403 JW3366 protein protein ecoli Escherichia coli (strain K12) MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTGIFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFVVDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEIYNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQYAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNLAIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL pgk_ecoli Phosphoglycerate kinase pgk b2926 JW2893 protein protein ecoli Escherichia coli (strain K12) MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVAEGELVVLENVRFNKGEKKDDETLSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTCNIPVPSDVRVATEFSETAPATLKSVNDVKADEQILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEERAKK 6-phospho-d-gluconic acid 6-phospho-D-gluconic acid 6-Phospho-D-gluconate 6-O-phosphono-D-gluconic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) alkh_ecoli KHG/KDPG aldolase hga kdgA b1850 eda JW1839 protein protein ecoli Escherichia coli (strain K12) MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAKL mao2_ecoli NADP-dependent malic enzyme maeB b2463 ypfF JW2447 protein protein ecoli Escherichia coli (strain K12) MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFIEVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAYAVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKLTEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIGAIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYVNDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAPELMIDGEMHGDAALVEAIRNDRMPDSSLKGSANILVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL g6pi_ecoli Glucose-6-phosphate isomerase JW3985 pgi b4025 Phosphoglucose isomerase Phosphohexose isomerase protein protein ecoli Escherichia coli (strain K12) MKNINPTQTAAWQALQKHFDEMKDVTIADLFAKDGDRFSKFSATFDDQMLVDYSKNRITEETLAKLQDLAKECDLAGAIKSMFSGEKINRTENRAVLHVALRNRSNTPILVDGKDVMPEVNAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSARDWFLKAAGDEKHVAKHFAALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIVLSIGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLSDHHQKLLSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLDYVVPFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIFTFDQWGVELGKQLANRILPELKDDKEISSHDSSTNGLINRYKAWRG g6pd_ecoli Glucose-6-phosphate 1-dehydrogenase zwf b1852 JW1841 protein protein ecoli Escherichia coli (strain K12) MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTKVVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQKNRITINYFAMPPSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLGKETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHLLQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPGYLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLFKESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMITRDGRSWNEFE amp Adenosine monophosphate 5'-Adenosine monophosphate 5'-Adenylic acid 5'-AMP 5'-O-phosphonoadenosine adenosine 5'-(dihydrogen phosphate) Adenosine 5'-monophosphate Adenosine 5'-phosphate ADENOSINE MONOPHOSPHATE adenosine phosphate Adenosine-5'-monophosphoric acid adenosine-5'P adenosini phosphas Adenylate Adenylic acid Ado5'P AMP fosfato de adenosina pA PAdo phosphate d'adenosine 5'-adenylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) acsa_ecoli Acetyl-coenzyme A synthetase acs b4069 JW4030 yfaC Acetate--CoA ligase Acyl-activating enzyme protein protein ecoli Escherichia coli (strain K12) MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS pfka_ecoli ATP-dependent 6-phosphofructokinase isozyme 1 6-phosphofructokinase isozyme I Phosphohexokinase 1 pfkA b3916 JW3887 protein protein ecoli Escherichia coli (strain K12) MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY This sequence has been withdrawn from Uniprot. D03D79F6A5536A41 rpe_ecoli Ribulose-phosphate 3-epimerase rpe dod b3386 yhfD Pentose-5-phosphate 3-epimerase R5P3E JW3349 protein protein ecoli Escherichia coli (strain K12) MKQYLIAPSILSADFARLGEDTAKALAAGADVVHFDVMDNHYVPNLTIGPMVLKSLRNYGITAPIDVHLMVKPVDRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPQTLDKLREVRRRIDESGFDIRLEVDGGVKVNNIGEIAAAGADMFVAGSAIFDQPDYKKVIDEMRSELAKVSHE rpia_ecoli Ribose-5-phosphate isomerase A rpiA b2914 JW5475 ygfC Phosphoriboisomerase A protein protein ecoli Escherichia coli (strain K12) MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADASKQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPIAMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK l-asparagine L-asparagine (2S)-2,4-diamino-4-oxobutanoic acid (2S)-2-amino-3-carbamoylpropanoic acid (S)-2-amino-3-carbamoylpropanoic acid (S)-Asparagine 2-Aminosuccinamic acid alpha-aminosuccinamic acid Asn ASPARAGINE Aspartamic acid L-2-aminosuccinamic acid L-Asparagin L-Asparagine L-aspartic acid beta-amide N L-asparagine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) edd_ecoli Phosphogluconate dehydratase 6-phosphogluconate dehydratase edd Entner-Doudoroff dehydrase JW1840 b1851 protein protein ecoli Escherichia coli (strain K12) MNPQLLRVTNRIIERSRETRSAYLARIEQAKTSTVHRSQLACGNLAHGFAACQPEDKASLKSMLRNNIAIITSYNDMLSAHQPYEHYPEIIRKALHEANAVGQVAGGVPAMCDGVTQGQDGMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIVPGLTMAALSFGHLPAVFVPSGPMASGLPNKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTANTNQMVVEFMGMQLPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKMIDEKVVVNGIVALLATGGSTNHTMHLVAMARAAGIQINWDDFSDLSDVVPLMARLYPNGPADINHFQAAGGVPVLVRELLKAGLLHEDVNTVAGFGLSRYTLEPWLNNGELDWREGAEKSLDSNVIASFEQPFSHHGGTKVLSGNLGRAVMKTSAVPVENQVIEAPAVVFESQHDVMPAFEAGLLDRDCVVVVRHQGPKANGMPELHKLMPPLGVLLDRCFKIALVTDGRLSGASGKVPSAIHVTPEAYDGGLLAKVRDGDIIRVNGQTGELTLLVDEAELAAREPHIPDLSASRVGTGRELFSALREKLSGAEQGATCITF gpma_ecoli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase gpmA gpm pgm pgmA b0755 JW0738 protein protein ecoli Escherichia coli (strain K12) MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) citric acid citric acid 2-Hydroxy-1,2,3-propanetricarboxylic acid 2-Hydroxytricarballylic acid 3-Carboxy-3-hydroxypentane-1,5-dioic acid Citric acid CITRIC ACID Citronensaeure E330 H3cit 2-hydroxypropane-1,2,3-tricarboxylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) idh_ecoli Isocitrate dehydrogenase [NADP] icd icdA icdE b1136 JW1122 Oxalosuccinate decarboxylase NADP(+)-specific ICDH IDP protein protein ecoli Escherichia coli (strain K12) MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGAFKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGAKLLKCSEFGDAIIENM ctp CTP 5'-CTP CTP Cytidine 5'-triphosphate Cytidine triphosphate CYTIDINE-5'-TRIPHOSPHATE H4ctp cytidine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) PCDQPRRSZKQHHS-XVFCMESISA-N lcystathionine L-cystathionine (R)-S-(2-amino-2-carboxyethyl)-L-Homocysteine L-(+)-Cystathionine L-Cystathionine S-(beta-amino-beta-carboxyethyl)homocysteine (2S)-2-amino-4-{[(2R)-2-amino-2-carboxyethyl]sulfanyl}butanoic acid L-cystathionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fad FAD - Flavin adenine dinucleotide Adenosine 5'-(trihydrogen pyrophosphate), 5'-5'-ester with riboflavine adenosine 5'-[3-(riboflavin-5'-yl) dihydrogen diphosphate] FAD Flavin adenine dinucleotide FLAVIN-ADENINE DINUCLEOTIDE Riboflavin 5'-(trihydrogen diphosphate), 5'-5'-ester with adenosine Riboflavin 5'-adenosine diphosphate adenosine 5'-(3-{D-ribo-5-[7,8-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl} dihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) Flavin adenine dinucleotide mdh_ecoli Malate dehydrogenase mdh b3236 JW3205 protein protein ecoli Escherichia coli (strain K12) MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK pta_ecoli Phosphate acetyltransferase Phosphotransacetylase pta b2297 JW2294 protein protein ecoli Escherichia coli (strain K12) MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRTGGDAPDQTTTIVRANSSTTTAAEPLKMSYVEGLLSSNQKDVLMEEIVANYHANTKDAEVVLVEGLVPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLKERIELTRNSFGGAKNTNITGVIVNKLNAPVDEQGRTRPDLSEIFDDSSKAKVNNVDPAKLQESSPLPVLGAVPWSFDLIATRAIDMARHLNATIINEGDINTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVLVAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSFNLEVPVDDHERIEKVQEYVANYINADWIESLTATSERSRRLSPPAFRYQLTELARKAGKRIVLPEGDEPRTVKAAAICAERGIATCVLLGNPAEINRVAASQGVELGAGIEIVDPEVVRESYVGRLVELRKNKGMTETVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSAAAFGIEPRVAMLSYSTGTSGAGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAPNSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQSAQQQ dfructose 1,6bisphosphate D-fructose 1,6-bisphosphate Diphosphofructose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dglucose 6phosphate D-glucose 6-phosphate 6-O-phosphono-D-glucose D-glucose 6-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 kpyk1_ecoli Pyruvate kinase I pykF b1676 JW1666 PK-1 protein protein ecoli Escherichia coli (strain K12) MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKLRITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL tpis_ecoli Triosephosphate isomerase tpiA tpi b3919 JW3890 Triose-phosphate isomerase protein protein ecoli Escherichia coli (strain K12) MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA E398251020012D94 lhistidine L-histidine (S)-4-(2-Amino-2-carboxyethyl)imidazole (S)-alpha-amino-1H-Imidazole-4-propanoic acid (S)-alpha-Amino-1H-imidazole-4-propionic acid H His HISTIDINE L-(-)-histidine L-Histidin L-Histidine (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid L-histidine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) imp IMP 2'-inosine-5'-monophosphate 5'-IMP 5'-Inosinate 5'-Inosine monophosphate 5'-Inosinic acid hypoxanthosine 5'-monophosphate IMP Inosine 5'-monophosphate Inosine 5'-phosphate Inosine monophosphate inosinic acid Inosinic acid ribosylhypoxanthine monophosphate 5'-inosinic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) GRSZFWQUAKGDAV-KQYNXXCUSA-N itaconic acid itaconic acid 2-methylenesuccinic acid 2-propene-1,2-dicarboxylic acid Itaconic acid methylenebutanedioic acid Methylenesuccinic acid propylenedicarboxylic acid 2-methylidenebutanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lleucine L-leucine (2S)-2-amino-4-methylpentanoic acid (2S)-alpha-2-Amino-4-methylvaleric acid (2S)-alpha-Leucine (S)-(+)-leucine (S)-leucine 2-Amino-4-methylvaleric acid L L-Leucin L-Leucine L-Leuzin Leu LEUCINE L-leucine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) malate malate malate anion malates malic acid anion small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) malonic acid malonic acid H2malo HOOC-CH2-COOH Malonic acid MALONIC ACID Propanedioic acid propanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nad NAD nicotinamide-adenine dinucleotide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nadp NADP nicotinamide-adenine dinucleotide phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphoenolpyruvate phosphoenolpyruvate 2-(phosphonooxy)-2-propenoate 2-(phosphonooxy)acrylate 2-hydroxy-2-propenoate (dihydrogen phosphate) (ester) 2-hydroxy-2-propenoate phosphate (ester) O-phosphono-enol-pyruvate PEP Phosphoenolpyruvate PHOSPHOENOLPYRUVATE phosphoenolpyruvate(1-) 2-(phosphonooxy)prop-2-enoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) eno_ecoli Enolase eno b2779 JW2750 2-phosphoglycerate dehydratase 2-phospho-D-glycerate hydro-lyase protein protein ecoli Escherichia coli (strain K12) MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA 5ophosphonoalphadribofuranosyl diphosphate 5-O-phosphono-alpha-D-ribofuranosyl diphosphate 5-Phospho-alpha-D-ribose 1-diphosphate 5-Phosphoribosyl 1-pyrophosphate 5-Phosphoribosyl diphosphate alpha-D-ribofuranose 5-(dihydrogen phosphate) 1-(trihydrogen diphosphate) ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID phosphoribosyl pyrophosphate phosphoribosylpyrophosphate PRib-PP PRPP 5-O-phosphono-alpha-D-ribofuranose 1-(trihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phenylpyruvate phenylpyruvate phenylpyruvates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dribulose 5phosphate D-ribulose 5-phosphate D-erythro-pent-2-ulose 5-(dihydrogen phosphate) D-Ribulose 5-phosphate 5-O-phosphono-D-ribulose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spermidine spermidine 1,5,10-triazadecane 4-azaoctamethylenediamine 4-azaoctane-1,8-diamine N-(3-Aminopropyl)-1,4-butane-diamine Spermidin SPERMIDINE Spermidine N-(3-aminopropyl)butane-1,4-diamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ATHGHQPFGPMSJY-UHFFFAOYSA-N fuma_ecoli Fumarate hydratase class I, aerobic fumA Fumarase A Oxaloacetate keto--enol-isomerase Oxaloacetate tautomerase JW1604 b1612 protein protein ecoli Escherichia coli (strain K12) MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASFMLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQRVWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKFLCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAETNLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVRVDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQLTQCTRCVK 6082744088C64603 ltryptophan L-tryptophan (2S)-2-amino-3-(1H-indol-3-yl)propanoic acid (S)-alpha-amino-1H-indole-3-propanoic acid (S)-alpha-Amino-beta-(3-indolyl)-propionic acid (S)-tryptophan L-(-)-tryptophan L-beta-3-indolylalanine L-Tryptophan L-tryptophan Trp Tryptophan TRYPTOPHAN tryptophan W L-tryptophan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dttp dTTP 2'-deoxythymidine triphosphate 5'-TTP deoxy-TTP Deoxythymidine 5'-triphosphate Deoxythymidine triphosphate dThd5'PPP dTTP pppdT thymidine 5'-triphosphate THYMIDINE-5'-TRIPHOSPHATE TTP thymidine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 3',5'-cyclic amp 3',5'-cyclic AMP 3',5'-Cyclic AMP adenosine 3',5'-cyclic monophosphate Adenosine 3',5'-cyclic phosphate Adenosine 3',5'-phosphate ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE cAMP Cyclic adenylic acid Cyclic AMP adenosine 3',5'-(hydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nadp+ 2'-O-phosphonoadenosine 5'-{3-[1-(3-carbamoylpyridinio)-1,4-anhydro-D-ribitol-5-yl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-glucopyranose 6-phosphate D-glucopyranose 6-phosphate 6-O-phosphono-D-glucopyranose D-Glucose 6-phosphate Glc6P Robison ester D-glucopyranose 6-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) coenzyme a coenzyme A [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]methyl (3R)-3-hydroxy-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)-2,2-dimethyl-4-oxobutyl dihydrogen diphosphate 3'-phosphoadenosine-(5')diphospho(4')pantatheine CoA CoA-SH CoASH Coenzym A Coenzyme A COENZYME A HSCoA Koenzym A 3'-phosphoadenosine 5'-{3-[(3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) acetyl dihydrogen phosphate acetyl dihydrogen phosphate acetic acid, monoanhydride with phosphoric acid acetyl dihydrogen phosphate Acetyl phosphate ACETYLPHOSPHATE acetylphosphoric acid monoacetyl phosphate (acetyloxy)phosphonic acid acetic phosphoric monoanhydride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 3phosphodglyceric acid-acea-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A AceA Isocitrate lyase 3636127 unspecified role unspecified role neutral component neutral component purified purified C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1959 Dataset EV2 RF = 0.1959 3phosphodglyceric acid-fbaa-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.5214 Dataset EV2 RF = 0.5214 3phosphodglyceric acid-gapa-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GapA Glyceraldehyde 3-phosphate dehydrogenase 3636129 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1897 Dataset EV2 RF = 0.1897 3phosphodglyceric acid-gnd-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Gnd 6-Phosphogluconate dehydrogenase 3636130 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1913 Dataset EV2 RF = 0.1913 3phosphodglyceric acid-maea-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1817 Dataset EV2 RF = 0.1817 3phosphodglyceric acid-pcka-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PckA PEP Carboxykinase 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4426 Dataset EV2 RF = 0.4426 3phosphodglyceric acid-pgk-1 3636122 N/A D-(-)-3-Phosphoglycerate 3PG 3636126 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3662 Dataset EV2 RF = 0.3662 6phosphodgluconic acid-eda-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 3636135 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4836 Dataset EV2 RF = 0.4836 6phosphodgluconic acid-fbaa-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2656 Dataset EV2 RF = 0.2656 6phosphodgluconic acid-gnd-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Gnd 6-Phosphogluconate dehydrogenase 3636130 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3524 Dataset EV2 RF = 0.3524 6phosphodgluconic acid-maea-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2719 Dataset EV2 RF = 0.2719 6phosphodgluconic acid-maeb-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1875 Dataset EV2 RF = 0.1875 6phosphodgluconic acid-pgi-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgi Phosphoglucose isomerase 3636137 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.5173 Dataset EV2 RF = 0.5173 6phosphodgluconic acid-pgk-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2482 Dataset EV2 RF = 0.2482 6phosphodgluconic acid-zwf-1 3636122 N/A 6-Phosphogluconate 6PG 3636134 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Zwf Glucose 6-phosphate-1-dehydrogenase 3636138 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1857 Dataset EV2 RF = 0.1857 acs-adenosine 5'monophosphate-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Acs Acetyl-CoA-synthetase 3636140 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2367 Dataset EV2 RF = 0.2367 adenosine 5'monophosphate-fbaa-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3258 Dataset EV2 RF = 0.3258 adenosine 5'monophosphate-gapa-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GapA Glyceraldehyde 3-phosphate dehydrogenase 3636129 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.7528 Dataset EV2 RF = 0.7528 adenosine 5'monophosphate-maeb-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2559 Dataset EV2 RF = 0.2559 adenosine 5'monophosphate-pcka-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PckA PEP Carboxykinase 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2752 Dataset EV2 RF = 0.2752 adenosine 5'monophosphate-pfka-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2317 Dataset EV2 RF = 0.2317 adenosine 5'monophosphate-pgk-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3166 Dataset EV2 RF = 0.3166 adenosine 5'monophosphate-rpe-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Rpe Ribulose-5-phosphate 3-epimerase 3636142 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3783 Dataset EV2 RF = 0.3783 adenosine 5'monophosphate-rpia-1 3636122 N/A Adenosine 5′-monophosphate AMP 3636139 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A RpiA Ribose-5-phosphate isomerase 3636143 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3729 Dataset EV2 RF = 0.3729 edd-lasparagine-1 3636122 N/A L-Asparagine ASN 3636144 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Edd Phosphogluconate dehydratase 3636145 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2815 Dataset EV2 RF = 0.2815 gpma-lasparagine-1 3636122 N/A L-Asparagine ASN 3636144 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  3636146 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1982 Dataset EV2 RF = 0.1982 lasparagine-maeb-1 3636122 N/A L-Asparagine ASN 3636144 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1888 Dataset EV2 RF = 0.1888 acs-atp-1 3636122 N/A Adenosine 5′-trihosphate ATP 3636147 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Acs Acetyl-CoA-synthetase 3636140 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2435 Dataset EV2 RF = 0.2435 atp-fbaa-1 3636122 N/A Adenosine 5′-trihosphate ATP 3636147 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3265 Dataset EV2 RF = 0.3265 atp-pcka-1 3636122 N/A Adenosine 5′-trihosphate ATP 3636147 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PEP Carboxykinase PckA 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3768 Dataset EV2 RF = 0.3768 atp-pgk-1 3636122 N/A Adenosine 5′-trihosphate ATP 3636147 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2997 Dataset EV2 RF = 0.2997 atp-zwf-1 3636122 N/A Adenosine 5′-trihosphate ATP 3636147 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Zwf Glucose 6-phosphate-1-dehydrogenase 3636138 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2212 Dataset EV2 RF = 0.2212 citric acid-fbaa-1 3636122 N/A Citrate CIT 3636148 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3812 Dataset EV2 RF = 0.3812 citric acid-icd-1 3636122 N/A Citrate CIT 3636148 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Icd Isocitrate dehydrogenase 3636149 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2224 Dataset EV2 RF = 0.2224 citric acid-maeb-1 3636122 N/A Citrate CIT 3636148 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2479 Dataset EV2 RF = 0.2479 citric acid-pcka-1 3636122 N/A Citrate CIT 3636148 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PckA PEP Carboxykinase 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1833 Dataset EV2 RF = 0.1833 ctp-edd-1 3636122 N/A Cytidine 5′-triphosphate CTP 3636150 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Edd Phosphogluconate dehydratase 3636145 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.194 Dataset EV2 RF = 0.194 ctp-pfka-1 3636122 N/A Cytidine 5′-triphosphate CTP 3636150 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3814 Dataset EV2 RF = 0.3814 edd-lcystathionine-1 3636122 N/A L-Cystathionine CYSTAT 3636151 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Edd Phosphogluconate dehydratase 3636145 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.222 Dataset EV2 RF = 0.222 acs-fad-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Acs Acetyl-CoA-synthetase 3636140 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2928 Dataset EV2 RF = 0.2928 fad-gapa-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GapA Glyceraldehyde 3-phosphate dehydrogenase 3636129 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4969 Dataset EV2 RF = 0.4969 fad-maea-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3875 Dataset EV2 RF = 0.3875 fad-mdh-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Mdh Malate dehydrogenase 3636153 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2228 Dataset EV2 RF = 0.2228 fad-pfka-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3287 Dataset EV2 RF = 0.3287 fad-pta-1 3636122 N/A Flavin adenine dinucleotide FAD 3636152 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pta Phosphate acetyltransferase  3636154 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2773 Dataset EV2 RF = 0.2773 dfructose 1,6bisphosphate-pfka-1 3636122 N/A D-Fructose 1,6-bisphosphate FBP 3636155 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1945 Dataset EV2 RF = 0.1945 dglucose 6phosphate-pgi-1 3636122 N/A D-Glucose-6-phosphate G6P 3636156 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgi Phosphoglucose isomerase 3636137 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4522 Dataset EV2 RF = 0.4522 dglucose 6phosphate-rpe-1 3636122 N/A D-Glucose-6-phosphate G6P 3636156 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Rpe Ribulose-5-phosphate 3-epimerase 3636142 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3682 Dataset EV2 RF = 0.3682 acs-gtp-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Acs Acetyl-CoA-synthetase 3636140 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.235 Dataset EV2 RF = 0.235 edd-gtp-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Edd Phosphogluconate dehydratase 3636145 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.269 Dataset EV2 RF = 0.269 fbaa-gtp-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.288 Dataset EV2 RF = 0.288 gnd-gtp-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Gnd 6-Phosphogluconate dehydrogenase 3636130 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2674 Dataset EV2 RF = 0.2674 gpma-gtp-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  3636146 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2117 Dataset EV2 RF = 0.2117 gtp-maeb-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.292 Dataset EV2 RF = 0.292 gtp-pfka-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3499 Dataset EV2 RF = 0.3499 gtp-pgi-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgi Phosphoglucose isomerase 3636137 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3184 Dataset EV2 RF = 0.3184 gtp-pgk-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3442 Dataset EV2 RF = 0.3442 gtp-pta-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pta Phosphate acetyltransferase  3636154 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2482 Dataset EV2 RF = 0.2482 gtp-pykf-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PykF Pyruvate kinase  3636158 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2596 Dataset EV2 RF = 0.2596 gtp-tpia-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A TpiA Triosephosphate isomerase 3636159 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2483 Dataset EV2 RF = 0.2483 gtp-zwf-1 3636122 N/A Guanosine 5′-triphosphate GTP 3636157 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Zwf Glucose 6-phosphate-1-dehydrogenase 3636138 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2289 Dataset EV2 RF = 0.2289 lhistidine-maea-1 3636122 N/A L-Histidine HIS 3636160 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1822 Dataset EV2 RF = 0.1822 lhistidine-maeb-1 3636122 N/A L-Histidine HIS 3636160 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2356 Dataset EV2 RF = 0.2356 lhistidine-pgk-1 3636122 N/A L-Histidine HIS 3636160 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2714 Dataset EV2 RF = 0.2714 imp-zwf-1 3636122 N/A Inosine 5′-monophosphate IMP 3636161 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Zwf Glucose 6-phosphate-1-dehydrogenase 3636138 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2748 Dataset EV2 RF = 0.2748 eda-itaconic acid-1 3636122 N/A Itaconate ITA 3636162 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 3636135 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2559 Dataset EV2 RF = 0.2559 lleucine-rpe-1 3636122 N/A L-Leucine LEU 3636163 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Rpe Ribulose-5-phosphate 3-epimerase 3636142 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1824 Dataset EV2 RF = 0.1824 maeb-malate-1 3636122 N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A L-Malate MAL 3636164 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2377 Dataset EV2 RF = 0.2377 malate-pgk-1 3636122 N/A L-Malate MAL 3636164 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgk Phosphoglycerate kinase 3636133 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2965 Dataset EV2 RF = 0.2965 acea-malonic acid-1 3636122 N/A Malonate MALON 3636165 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A AceA Isocitrate lyase 3636127 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2864 Dataset EV2 RF = 0.2864 fbaa-malonic acid-1 3636122 N/A Malonate MALON 3636165 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.5633 Dataset EV2 RF = 0.5633 maea-malonic acid-1 3636122 N/A Malonate MALON 3636165 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2632 Dataset EV2 RF = 0.2632 maeb-malonic acid-1 3636122 N/A Malonate MALON 3636165 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3192 Dataset EV2 RF = 0.3192 gapa-nad-1 3636122 N/A Nicotinamide adenine dinucleotide  NAD 3636166 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GapA Glyceraldehyde 3-phosphate dehydrogenase 3636129 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.5493 Dataset EV2 RF = 0.5493 maea-nad-1 3636122 N/A Nicotinamide adenine dinucleotide  NAD 3636166 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4975 Dataset EV2 RF = 0.4975 nad-pfka-1 3636122 N/A Nicotinamide adenine dinucleotide  NAD 3636166 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PfkA 6-Phosphofructokinase 3636141 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3465 Dataset EV2 RF = 0.3465 fbaa-nadp-1 3636122 N/A nicotinamide adenine dinucleotide phosphate  NADP 3636167 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2288 Dataset EV2 RF = 0.2288 gnd-nadp-1 3636122 N/A nicotinamide adenine dinucleotide phosphate  NADP 3636167 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Gnd 6-Phosphogluconate dehydrogenase 3636130 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3577 Dataset EV2 RF = 0.3577 icd-nadp-1 3636122 N/A nicotinamide adenine dinucleotide phosphate  NADP 3636167 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Icd Isocitrate dehydrogenase 3636149 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3145 Dataset EV2 RF = 0.3145 eda-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 3636135 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1923 Dataset EV2 RF = 0.1923 eno-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Eno Enolase 3636169 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2497 Dataset EV2 RF = 0.2497 fbaa-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1974 Dataset EV2 RF = 0.1974 gpma-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  3636146 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.6324 Dataset EV2 RF = 0.6324 icd-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Icd Isocitrate dehydrogenase 3636149 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1942 Dataset EV2 RF = 0.1942 pcka-phosphoenolpyruvate-1 3636122 N/A Phosphoenolpyruvate PEP 3636168 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PckA PEP Carboxykinase 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4234 Dataset EV2 RF = 0.4234 5ophosphonoalphadribofuranosyl diphosphate-fbaa-1 3636122 N/A 5-Phospho-D-ribose 1-diphosphate PRPP 3636170 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2275 Dataset EV2 RF = 0.2275 fbaa-phenylpyruvate-1 3636122 N/A Phenylpyruvate PhePYR 3636171 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.1828 Dataset EV2 RF = 0.1828 maeb-phenylpyruvate-1 3636122 N/A Phenylpyruvate PhePYR 3636171 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2987 Dataset EV2 RF = 0.2987 phenylpyruvate-pta-1 3636122 N/A Phenylpyruvate PhePYR 3636171 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pta Phosphate acetyltransferase  3636154 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2416 Dataset EV2 RF = 0.2416 dribulose 5phosphate-pgi-1 3636122 N/A D-Ribulose-5-phosphate R5P 3636172 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pgi Phosphoglucose isomerase 3636137 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2564 Dataset EV2 RF = 0.2564 fuma-spermidine-1 3636122 N/A Spermidine SPER 3636173 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FumA Fumarase 3636174 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2789 Dataset EV2 RF = 0.2789 ltryptophan-maeb-1 3636122 N/A L-Tryptophan TRP 3636175 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2985 Dataset EV2 RF = 0.2985 ltryptophan-pta-1 3636122 N/A L-Tryptophan TRP 3636175 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Pta Phosphate acetyltransferase  3636154 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2164 Dataset EV2 RF = 0.2164 dttp-pcka-1 3636122 N/A Thymidine 5′-triphosphate TTP 3636176 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A PckA PEP Carboxykinase 3636132 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2596 Dataset EV2 RF = 0.2596 3',5'cyclic amp-acs-1 3636122 N/A Adenosine 3′,5′-cyclic monophosphate cAMP 3636177 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Acs Acetyl-CoA-synthetase 3636140 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.3737 Dataset EV2 RF = 0.3737 3',5'cyclic amp-gapa-1 3636122 N/A Adenosine 3′,5′-cyclic monophosphate cAMP 3636177 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A GapA Glyceraldehyde 3-phosphate dehydrogenase 3636129 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.4736 Dataset EV2 RF = 0.4736 3',5'cyclic amp-maea-1 3636122 N/A Adenosine 3′,5′-cyclic monophosphate cAMP 3636177 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeA Malic enzyme 3636131 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2858 Dataset EV2 RF = 0.2858 3',5'cyclic amp-maeb-1 3636122 N/A Adenosine 3′,5′-cyclic monophosphate cAMP 3636177 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A MaeB Malic enzyme 3636136 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. RF = 0.2883 Dataset EV2 RF = 0.2883 d_glucopyranose 6_phosphate-nadp+-1 3636123 N/A 3636178 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3636179 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Zwf Glucose 6-phosphate-1-dehydrogenase 3636138 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 5A, Dataset EV3 ATP (CHEBI:15422) GTP (CHEBI:15996) pta-1 3636124 N/A 3636180 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3636181 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A Phosphate acetyltransferase Pta 3636154 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 5B, Dataset EV3 The assay showed a small, but insignificant concentration‐dependent inhibitory effect of phenylpyruvate (CHEBI:26008) and no inhibitory effect of l‐tryptophan (CHEBI:16828) on phosphate acetyltransferase activity. fbaa-4 3636125 N/A 3636155 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A FbaA Fructose bisphosphate aldolase 3636128 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 5C, Dataset EV3 3PG (CHEBI:17794) ATP (CHEBI:15422) PEP (CHEBI:18021)