IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chrucicka-2019-1 human-293a Homo sapiens hek293a hek293a fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Chruścicka B., Wallace Fitzsimons SE., Borroto-Escuela DO., Druelle C., Stamou P., Nally K., Dinan TG., Cryan JF., Fuxe K., Schellekens H. OTR tagged with GFP has been assumed to have originated from:pCMV6-AC-OXTR-GFP plasmid -RG211797; OriGene Tag Fluorescence was detected by FACS. H.Schellekens@ucc.ie ACS chemical neuroscience 2019 Only protein-protein interactions imex curation imex curation chrucicka-2019-2 human-293a Homo sapiens hek293a hek293a confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Chruścicka B., Wallace Fitzsimons SE., Borroto-Escuela DO., Druelle C., Stamou P., Nally K., Dinan TG., Cryan JF., Fuxe K., Schellekens H. H.Schellekens@ucc.ie ACS chemical neuroscience 2019 Only protein-protein interactions imex curation imex curation chrucicka-2019-3 rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Chruścicka B., Wallace Fitzsimons SE., Borroto-Escuela DO., Druelle C., Stamou P., Nally K., Dinan TG., Cryan JF., Fuxe K., Schellekens H. H.Schellekens@ucc.ie ACS chemical neuroscience 2019 Only protein-protein interactions imex curation imex curation chrucicka-2019-4 rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Chruścicka B., Wallace Fitzsimons SE., Borroto-Escuela DO., Druelle C., Stamou P., Nally K., Dinan TG., Cryan JF., Fuxe K., Schellekens H. H.Schellekens@ucc.ie ACS chemical neuroscience 2019 Only protein-protein interactions imex curation imex curation chrucicka-2019-5 rat-brain-nucleus accumbens Rat brain nucleus accumbens nucleus accumbens Nucleus accumbens pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Chruścicka B., Wallace Fitzsimons SE., Borroto-Escuela DO., Druelle C., Stamou P., Nally K., Dinan TG., Cryan JF., Fuxe K., Schellekens H. H.Schellekens@ucc.ie ACS chemical neuroscience 2019 Only protein-protein interactions imex curation imex curation oxyr_human Oxytocin receptor OXTR protein protein human Homo sapiens Human MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA 5ht2a_human 5-hydroxytryptamine receptor 2A HTR2A HTR2 Serotonin receptor 2A protein protein human Homo sapiens Human MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV 5ht2a_rat 5-hydroxytryptamine receptor 2A Htr2a Htr2 Serotonin receptor 2A protein protein rat Rattus norvegicus (Rat) Rat MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGYLPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYKSSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production mint oxyr_rat Oxytocin receptor Oxtr Otr protein protein rat Rattus norvegicus (Rat) Rat MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACVLLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDVNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETSVSKKSNSSTFVLSRRSSSQRSCSQPSSA oxtr-1 3575551 N/A 3575556 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3575556 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Supplementary figure 1 oxtr-2 3575551 N/A 3575556 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3575557 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1 htr2a-oxtr-1 3575552 N/A 3575557 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3575556 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 2 htr2a-oxtr-2 3575553 N/A 3575558 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N/A 3575559 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3A A high density of PLA positive OTR-5HTR 2A heteroreceptor complexes clusters was found in the pyramidal cell layer of the CA2 and CA3 regions. Positive complexes were also found in PoDG (polymorph layer of the dentate gyrus). htr2a-oxtr-3 3575554 N/A 3575558 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N/A 3575559 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3B In the cingulate cortex PLA positive OTR-5HTR 2A heteroreceptor complexes clusters are found in layers II and III. htr2a-oxtr-4 3575555 N/A 3575558 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N/A 3575559 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3B PLA positive clusters was found in the nucleus accumbens shell and core.