UniProt UniProt http://www.uniprot.org zhou-2019-1 human-sk-n-sh Homo sapiens, SK-N-SH Caucasian Neuroblastoma Cell Line sk-n-sh sk-n-sh anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou W., Ma D., Sun AX., Tran HD., Ma DL., Singh BK., Zhou J., Zhang J., Wang D., Zhao Y., Yen PM., Goh E., Tan EK. gnrtek@sgh.com.sg Human molecular genetics 2019 Only protein-protein interactions imex curation imex curation zhou-2019-2 human-brain Homo sapiens brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou W., Ma D., Sun AX., Tran HD., Ma DL., Singh BK., Zhou J., Zhang J., Wang D., Zhao Y., Yen PM., Goh E., Tan EK. gnrtek@sgh.com.sg Human molecular genetics 2019 Only protein-protein interactions imex curation imex curation zhou-2019-3 human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou W., Ma D., Sun AX., Tran HD., Ma DL., Singh BK., Zhou J., Zhang J., Wang D., Zhao Y., Yen PM., Goh E., Tan EK. Human stem cell lines harboring homozygous R145Q−/−that produced CHCHD2 Arg145Gln with no CHCHD2 WT protein. Interaction described in comparison with isogenic wild-type cells. gnrtek@sgh.com.sg Human molecular genetics 2019 Only protein-protein interactions imex curation imex curation zhou-2019-4 human-sk-n-sh Homo sapiens, SK-N-SH Caucasian Neuroblastoma Cell Line sk-n-sh sk-n-sh fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Zhou W., Ma D., Sun AX., Tran HD., Ma DL., Singh BK., Zhou J., Zhang J., Wang D., Zhao Y., Yen PM., Goh E., Tan EK. gnrtek@sgh.com.sg Human molecular genetics 2019 Only protein-protein interactions imex curation imex curation chch2_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 CHCHD2 C7orf17 HCV NS2 trans-regulated protein Aging-associated gene 10 protein AAG10 protein protein human Homo sapiens Human MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA chc10_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial Protein N27C7-4 CHCHD10 C22orf16 protein protein human Homo sapiens Human MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP chchd2-chchd10-1 3554995 N/A 3554999 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3555000 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5A chchd10-chchd2-1 3554995 N/A 3554999 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3555000 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5B chchd2-chchd10-3 3554995 N/A 3554999 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed engineered engineered region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q9Y6H1:p.Arg145Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9Y6H1:p.Thr61Ile mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3555000 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5D chchd2-chchd10-2 3554996 N/A 3554999 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3555000 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5C chchd2-chchd10-4 3554997 N/A 3554999 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Q9Y6H1:p.Arg145Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3555000 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5E, 5F chchd10-chchd2-2 3554998 N/A 3554999 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3555000 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 6A