IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ swinkels-2018-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Swinkels M., Zhang JH., Tilakaratna V., Black G., Perveen R., McHarg S., Inforzato A., Day AJ., Clark SJ. Details of FHL-1 expression were obtained from PMID:21146613. No details for CCP67 (402Y/402H ± tail) expression could be found. anthony.day@manchester.ac.uk Scientific reports 2018 Only protein-protein interactions imex curation imex curation p08603-pro_0000005894 Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR 19 1231 crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR p08603-2 Complement factor H CFH HF HF1 HF2 FHL-1 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS crp-cfh-22 3595210 N/A 3595211 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 direct interaction direct interaction false false false 1B crp-cfh-23 3595210 N/A 3595213 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 direct interaction direct interaction false false false 1C crp-cfh-24 3595210 N/A 3595213 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 5.0 direct interaction direct interaction false false false 1D crp-cfh-25 3595210 N/A 3595214 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 direct interaction direct interaction false false false 1E crp-cfh-26 3595210 N/A 3595214 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 5.0 direct interaction direct interaction false false false 1F crp-cfh-27 3595210 N/A 3595214 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range false P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 direct interaction direct interaction false false false 2A/C The FHL-1 tail [aas 446-449] had a positive influence on the binding of the 402Y form of CCP67 to mCRP (Fig. 2A) crp-cfh-28 3595210 N/A 3595214 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range false P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 5.0 direct interaction direct interaction false false false 2 B/D No effect of the tail [aas 446-449] on the binding of the 402 H form of CCP67 to either mCRP or pCRP was observed. crp-cfh-29 3595210 N/A 3595211 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma N/A 3595215 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 direct interaction direct interaction false false false 3A cfh-ptx3-6 3595210 N/A 3595214 unspecified role unspecified role bait bait purified purified P08603-2:p.Tyr402His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3595215 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 direct interaction direct interaction false false false 3B crp-cfh-30 3595210 N/A 3595214 unspecified role unspecified role bait bait purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range false P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 3595215 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 Stoichiometry: 1.0 direct interaction direct interaction false false false 3 C/D The C-terminal tail of FHL-1 [aas 446-449] was found to make a significant contribution to the interaction with PTX3 in the context of both the 402Y and 402H variants. crp-cfh-31 3595210 N/A 3595214 competitor competitor competitor prey prey picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3595211 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 physical association physical association false false false Supp. fig 2 crp-cfh-32 3595210 N/A 3595214 unspecified role unspecified role prey prey purified purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3595215 competitor competitor competitor prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 N/A 3595212 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma Stoichiometry: 1.0 physical association physical association false false false Supp. fig 4