IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ albee-2017-4 human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation albee-2017-2 human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation albee-2017-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation albee-2017-3 human-smooth muscle Homo sapiens smooth_muscle smooth muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK tm7_peptide TM7_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DDDLHVTQCLSLVHCCVNPVLYSFIN ada1d_human Alpha-1D adrenergic receptor Alpha-1D adrenoreceptor Alpha-1A adrenergic receptor Alpha-adrenergic receptor 1a ADRA1D ADRA1A protein protein human Homo sapiens Human MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAGSGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVPPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRETDI tm2_peptide TM2_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YILNLAIADLWVVLTIPVWVVDDD ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF tm4_peptide TM4_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VVCILWLLAFCVSLPDTYYLDD cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS ada2b_human Alpha-2B adrenergic receptor ADRA2B ADRA2L1 ADRA2RL1 Alpha-2 adrenergic receptor subtype C2 Alpha-2B adrenoreceptor protein protein human Homo sapiens Human MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW ackr3-adra1a-5 3554676 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554682 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -2 The TM7 peptide analog significantly increased PLA signals. TM4 and 2 had no effect. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) ackr3-ackr3-1 3554676 N/A 3554683 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554684 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -1 The TM2 peptide analog significantly reduced PLA signals; TM4 and 7 had no effect. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-adra1d-3 3554676 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554684 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -3 The TM2 and TM4 peptide analogs significantly reduced PLA signals; TM7 had no effect. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-adra1b-4 3554676 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554686 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -4 The TM2 and TM4 peptide analogs significantly reduced PLA signals; TM7 had no effect. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) ackr3-adra1d-4 3554676 N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554684 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -5 All TM peptide analogs significantly reduced PLA signals. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-cxcr4-3 3554676 N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554686 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -6 All TM peptide analogs significantly reduced PLA signals. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) ackr3-cxcr4-4 3554676 N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554682 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -7 All TM peptide analogs significantly reduced PLA signals. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) ackr3-adra1a-6 3554676 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554682 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -8 All peptide analogs significantly increased PLA signals. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) adra1a-cxcr4-1 3554676 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554686 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -9 All peptide analogs significantly increased PLA signals. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) adra1a-cxcr4-2 3554676 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554684 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -10 All peptide analogs significantly increased PLA signals. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) adra1a-cxcr4-3 3554676 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554684 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -11 All peptide analogs significantly increased PLA signals;however addition of the TM7 peptide did not achieve the P<0.05 significance level. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) adra1b-cxcr4-1 3554676 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554686 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7+8 B/D -12 All peptide analogs significantly increased PLA signals;however addition of the TM7 peptide did not achieve the P<0.05 significance level. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) 9-ipojk;-1 3554677 N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4 A/B, 5A-C, 7+8 A-D siRNA knockdown of ACKR3 significantly reduced PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-cxcr4-2 3554677 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 5A-C, 6A/C,8 B/D siRNA knockdown of ACKR3 did not significantly reduce PLA signals. ackr3-adra1a-2 3554677 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4 A/B, 5A-C, 6B/D, 7 +8 A-D siRNA knockdown of ACKR3 or CXCR4 significantly reduced PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-adra1b-3 3554677 N/A 3554683 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4 A/B, 5A-C, 6B/D, 7+8 A-D siRNA knockdown of ACKR3 or CXCR4 significantly reduced PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-adra1d-2 3554677 N/A 3554688 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4 A/B-5 ackr3-adra1a-4 3554677 N/A 3554680 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4A-B, 5A-C, 6B/D, 7+8 A-D siRNA knockdown of ACKR3 or CXCR4 did not significantly reduce PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) adra1d-cxcr4-1 3554677 N/A 3554683 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 6 A/C, 8 B/D siRNA knockdown of ACKR3 significantly reduced PLA signals. Addition of all TM peptides had NO effect on this interaction. adra1d-cxcr4-2 3554677 N/A 3554685 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554687 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 6 A/C, 7+8 A-D siRNA knockdown of ACKR3 significantly reduced PLA signals. ackr3-adra1a-1 3554678 N/A 3554680 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3554681 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3-1 ackr3-adra1b-1 3554678 N/A 3554685 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3554681 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3-2 ackr3-adra1b-2 3554678 N/A 3554683 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3554681 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3-3 ackr3-adra1d-1 3554678 N/A 3554687 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3554681 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3-4 ackr3-cxcr4-1 3554678 N/A 3554687 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3554680 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3-5 ackr3-adra1a-3 3554679 N/A 3554688 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554683 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554685 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554680 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554681 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Figure 4D-G