IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ huang-2017-4 mouse-cerebrovascular_endothelium mouse cerebrovascular endothelial cells cerebrovascular_endothelium cerebrovascular endothelial cell Endothelial cell of or involving the cerebrum and the blood vessels supplying it. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com Scientific reports 2017 Only protein-protein interactions imex curation imex curation huang-2017-10 mouse-cerebrovascular_endothelium mouse cerebrovascular endothelial cells cerebrovascular_endothelium cerebrovascular endothelial cell Endothelial cell of or involving the cerebrum and the blood vessels supplying it. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com Scientific reports 2017 Only protein-protein interactions imex curation imex curation pparg_mouse Peroxisome proliferator-activated receptor gamma Pparg Nr1c3 Nuclear receptor subfamily 1 group C member 3 protein protein mouse Mus musculus Mouse MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY irf6_mouse Interferon regulatory factor 6 Irf6 protein protein mouse Mus musculus Mouse MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEGVDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQTQGSVINPGSTGSAPWDEKDNDVDEDEEEDELEQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPESVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLAAPNLIERQKKVKLFCLETFLSELIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPAPSMQLPQALPAQ mir106a_mouse_gene Mir106a mouse gene gene gene mouse Mus musculus Mouse irf6-pparg-1 3543178 N/A 3543180 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3543181 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig: 1b irf6-1 3543178 N/A 3543180 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3543181 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig: 1b pparg-11 3543179 N/A 3543182 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level putative PPRE site miR-106a promoter sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Promoter position: −2262/−2248. N/A 3543180 unspecified role unspecified role bait bait living cell living cell expression modif expression level alteration expression modif physical association physical association false false false 6C, D