IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ anastasio-2013-1 crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Anastasio NC., Gilbertson SR., Bubar MJ., Agarkov A., Stutz SJ., Jeng Y., Bremer NM., Smith TD., Fox RG., Swinford SE., Seitz PK., Charendoff MN., Craft JW., Laezza FM., Watson CS., Briggs JM., Cunningham KA. kcunning@utmb.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Only protein-protein interactions imex curation imex curation anastasio-2013-2 rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Anastasio NC., Gilbertson SR., Bubar MJ., Agarkov A., Stutz SJ., Jeng Y., Bremer NM., Smith TD., Fox RG., Swinford SE., Seitz PK., Charendoff MN., Craft JW., Laezza FM., Watson CS., Briggs JM., Cunningham KA. ventral tegmental area (VTA) kcunning@utmb.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Only protein-protein interactions imex curation imex curation anastasio-2013-3 crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Anastasio NC., Gilbertson SR., Bubar MJ., Agarkov A., Stutz SJ., Jeng Y., Bremer NM., Smith TD., Fox RG., Swinford SE., Seitz PK., Charendoff MN., Craft JW., Laezza FM., Watson CS., Briggs JM., Cunningham KA. kcunning@utmb.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Only protein-protein interactions imex curation imex curation a0a061ibi8_crigr Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Phosphatase and tensin homolog H671_3g9895 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV 5ht2c_human 5-hydroxytryptamine receptor 2C 5-hydroxytryptamine receptor 1C Serotonin receptor 2C HTR2C HTR1C protein protein human Homo sapiens Human MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV o54857_rat Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Phosphatase and tensin homolog Pten PTEN/MMAC1 rCG_47874 protein protein rat Rattus norvegicus (Rat) Rat MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKLMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV mint 5ht2c_rat 5-hydroxytryptamine receptor 2C Htr2c 5ht1c Htr1c Serotonin receptor 2C 5-hydroxytryptamine receptor 1C protein protein rat Rattus norvegicus (Rat) Rat MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIYVLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRGTMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRHTNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV mint This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system htr2c-a0a061ibi8_crigr-1 3559668 N/A 3559671 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3559672 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 2A/B 3L4F peptide; (Ac-PNQDQNARRRKKKERR-NH2; Pro280–Arg295 of the human 5-HT2CR) htr2c-pten-1 3559669 N/A 3559673 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 3559674 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association false false false Figure 2F rat TAT–3L4F peptide from rat 5-HT2CR :(TAT-cell penetrating peptide) GRKKRRQRRRPQ- Ac-YGRKKRRQRRRPNPDQKPRRKKKEKR-NH2 htr2c-a0a061ibi8_crigr-2 3559670 N/A 3559671 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3559672 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3 3L4F peptide; (Ac-PNQDQNARRRKKKERR-NH2; Pro280–Arg295 of the human 5-HT2CR)