IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mak-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca adult human kidney Cell reports 2012 Only protein-protein interactions imex curation imex curation mak-2012-2 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Cell reports 2012 Only protein-protein interactions imex curation imex curation mak-2012-3 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Cell reports 2012 Only protein-protein interactions imex curation imex curation mak-2012-5 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Cell reports 2012 Only protein-protein interactions imex curation imex curation mak-2012-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Cell reports 2012 Only protein-protein interactions imex curation imex curation mak-2012-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Mak AB., Nixon AM., Kittanakom S., Stewart JM., Chen GI., Curak J., Gingras AC., Mazitschek R., Neel BG., Stagljar I., Moffat J. Results from figures 2D and 6B have not been included as the species origin of constructs used is not stated. The Prey is fused to NubG which has a glycine to Isoleucine mutation at residue 13. (This reduces spontaneous reassociation with Cub when both are expressed.) CD133/Prominin-1 in the pLD-puro-CcVA vector was confirmed as having Uniprot ID of O43490-2 as found from previous work by the first author: Mak-2011publication (PMID:21937449) - Image clone 4644690, GenBank protein_id=AAH12089.1. Elsewhere CD133 has also been assumed to be of Human origin. HDAC6 was found to be of Human origin by BLAT of primers given in Table S4. MAPLE vectors pLD-puro-CnVA or pLD-puro-CcVA are found listed in the Addgene repository, donor is last author J.Moffat;(Addgene plasmid # 24587/8) j.moffat@utoronto.ca Cell reports 2012 Only protein-protein interactions imex curation imex curation yipf6_human Protein YIPF6 YIP1 family member 6 YIPF6 protein protein human Homo sapiens Human MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ prom1_human Prominin-1 PROM1 PROML1 Antigen AC133 Prominin-like protein 1 MSTP061 protein protein human Homo sapiens Human MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH cyb5_human Cytochrome b5 CYB5A CYB5 Microsomal cytochrome b5 type A protein protein human Homo sapiens Human MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED serp1_human Stress-associated endoplasmic reticulum protein 1 SERP1 RAMP4 Ribosome-attached membrane protein 4 protein protein human Homo sapiens Human MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM tm230_human Transmembrane protein 230 TMEM230 C20orf30 HSPC274 UNQ2432/PRO4992 protein protein human Homo sapiens Human MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD ccl2_human C-C motif chemokine 2 CCL2 MCP1 SCYA2 Small-inducible cytokine A2 Monocyte chemoattractant protein 1 Monocyte chemotactic protein 1 Monocyte chemotactic and activating factor Monocyte secretory protein JE HC11 protein protein human Homo sapiens Human MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT q8ni32-2 Ly6/PLAUR domain-containing protein 6B LYPD6B protein protein human Homo sapiens Human MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL No experimental confirmation available. bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE tm165_human Transmembrane protein 165 TMEM165 TPARL Transmembrane protein PT27 Transmembrane protein TPARL protein protein human Homo sapiens Human MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSGF aif1l_human Allograft inflammatory factor 1-like UNQ672/PRO1306 AIF1L C9orf58 IBA2 Ionized calcium-binding adapter molecule 2 protein protein human Homo sapiens Human MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP vkor1_human Vitamin K epoxide reductase complex subunit 1 VKORC1 VKOR Vitamin K1 2,3-epoxide reductase subunit 1 MSTP134 MSTP576 UNQ308/PRO351 protein protein human Homo sapiens Human MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH ifm1_human Interferon-induced transmembrane protein 1 IFITM1 IFI17 Interferon-inducible protein 9-27 Interferon-induced protein 17 Leu-13 antigen CD225 Dispanin subfamily A member 2a protein protein human Homo sapiens Human MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY ifm3_human Interferon-induced transmembrane protein 3 IFITM3 Dispanin subfamily A member 2b Interferon-inducible protein 1-8U protein protein human Homo sapiens Human MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG mint cc167_human Coiled-coil domain-containing protein 167 CCDC167 C6orf129 HSPC265 protein protein human Homo sapiens Human MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM ghitm_human Growth hormone-inducible transmembrane protein GHITM DERP2 MICS1 TMBIM5 Dermal papilla-derived protein 2 Mitochondrial morphology and cristae structure 1 Transmembrane BAX inhibitor motif-containing protein 5 My021 UNQ244/PRO281 protein protein human Homo sapiens Human MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK spcs1_human Signal peptidase complex subunit 1 SPCS1 SPC12 Microsomal signal peptidase 12 kDa subunit HSPC033 protein protein human Homo sapiens Human MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE at5g3_human ATP synthase F(0) complex subunit C3, mitochondrial ATP5MC3 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 3 ATP synthase proteolipid P3 ATP synthase proton-transporting mitochondrial F(0) complex subunit C3 ATP5G3 ATPase protein 9 ATPase subunit c protein protein human Homo sapiens Human MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM elov5_human Elongation of very long chain fatty acids protein 5 Very long chain 3-ketoacyl-CoA synthase 5 Very long chain 3-oxoacyl-CoA synthase 5 PRO0530 ELOVL5 3-keto acyl-CoA synthase ELOVL5 ELOVL fatty acid elongase 5 ELOVL2 Fatty acid elongase 1 protein protein human Homo sapiens Human MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD o95490-2 Adhesion G protein-coupled receptor L2 Calcium-independent alpha-latrotoxin receptor 2 Latrophilin homolog 1 Latrophilin-2 Lectomedin-1 Lectomedin-1 gamma ADGRL2 KIAA0786 LEC1 LPHH1 LPHN2 protein protein human Homo sapiens Human MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTYKYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRTDTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEATWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPNQYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIISTTSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWPQTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAASLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIYRSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYAIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMPNLRDSPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL plp2_human Proteolipid protein 2 Intestinal membrane A4 protein Differentiation-dependent protein A4 PLP2 A4 protein protein human Homo sapiens Human MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV q8n6l1-2 Keratinocyte-associated protein 2 KRTCAP2 KCP2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 protein protein human Homo sapiens Human MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN Produced at low levels due to suboptimal Kozak context. q9buf7-2 Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 B protein protein human Homo sapiens Human MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI itm2b_human Integral membrane protein 2B ITM2B BRI BRI2 Protein E25B Transmembrane protein BRI Immature BRI2 protein protein human Homo sapiens Human MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS cln5_human Ceroid-lipofuscinosis neuronal protein 5 CLN5 protein protein human Homo sapiens Human MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL hdac6_human Histone deacetylase 6 HDAC6 KIAA0901 JM21 Tubulin-lysine deacetylase HDAC6 protein protein human Homo sapiens Human MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH o43490-2 Prominin-1 PROM1 PROML1 Antigen AC133 Prominin-like protein 1 MSTP061 AC133-2 S1 protein protein human Homo sapiens Human MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH ccd63_human Coiled-coil domain-containing protein 63 CCDC63 protein protein human Homo sapiens Human MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQYKEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAELDEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQAKREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEVEGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPFSDRLDDVEQPLDHSSLRQLVLDNYILKENRSKEVRGDSLPEKVDDFRSRKKVTM apbb1-hdac6-2 3576012 N/A 3576018 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -1 apbb1-yipf6-1 3576012 N/A 3576020 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -2 apbb1-yipf6-2 3576012 N/A 3576021 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -3 apbb1-yipf6-3 3576012 N/A 3576022 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -4 apbb1-yipf6-4 3576012 N/A 3576023 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -5 apbb1-yipf6-5 3576012 N/A 3576024 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -6 apbb1-yipf6-6 3576012 N/A 3576025 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -7 apbb1-yipf6-7 3576012 N/A 3576026 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -8 apbb1-yipf6-8 3576012 N/A 3576027 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -9 apbb1-yipf6-9 3576012 N/A 3576028 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -10 apbb1-yipf6-10 3576012 N/A 3576029 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -11 apbb1-yipf6-11 3576012 N/A 3576030 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -12 apbb1-yipf6-12 3576012 N/A 3576031 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -13 apbb1-yipf6-13 3576012 N/A 3576032 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -14 apbb1-yipf6-14 3576012 N/A 3576033 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -15 apbb1-yipf6-15 3576012 N/A 3576034 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -16 apbb1-yipf6-16 3576012 N/A 3576035 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -17 apbb1-yipf6-17 3576012 N/A 3576036 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -18 apbb1-yipf6-18 3576012 N/A 3576037 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -19 apbb1-yipf6-20 3576012 N/A 3576038 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -20 apbb1-yipf6-21 3576012 N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3576039 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -21 apbb1-yipf6-22 3576012 N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3576040 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -22 apbb1-yipf6-23 3576012 N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3576041 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -23 apbb1-yipf6-24 3576012 N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3576042 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -24 apbb1-yipf6-25 3576012 N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3576043 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Table 2 -25 prom1-hdac6-2 3576013 N/A 3576044 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576045 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576019 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supplementary Figure 1A hdac6-ctnnb1-1 3576013 N/A 3576044 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576045 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576019 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supplementary Figure 1A, figure 6A hdac6-ctnnb1-2 3576013 N/A 3576044 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576045 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576019 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Figure 6A prom1-hdac6-3 3576014 N/A 3576045 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576046 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1A/B prom1-hdac6-4 3576014 N/A 3576019 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576045 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9UBN7:p.Ser568Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q9UBN7:p.Ser568Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9UBN7:p.Tyr570Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9UBN7:p.Tyr570Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9UBN7:p.[His216Ala;His611Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1C/D 2343242-1 3576015 N/A 3576044 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576045 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576019 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Supplementary figure 6A A striking colocalization of CD133 and beta-catenin ( Pearson’s correlation = 0.82) was found. By contrast, only a small fraction of HDAC6 colocalized with CD133 and beta-catenin. apbb1-ccdc63-1 3576015 N/A 3576047 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576019 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Figure 2E, supplementary figure 3D Tubacin -a HDAC6-specific small-molecule inhibitor Cells treated with HDAC6 shRNAs showed greater colocalisation. prom1-hdac6-1 3576016 N/A 3576045 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576046 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Table S1 apbb1-hdac6-1 3576017 N/A 3576045 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3576019 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 1E, Supplementary Figure 1C