MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jackson-2011-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation jackson-2011-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation jackson-2011-4 human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation jackson-2011-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation jackson-2011-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. imaging technique imaging technique microscopy tag visualisation tag visualisation Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation jackson-2011-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jackson BR., Boyne JR., Noerenberg M., Taylor A., Hautbergue GM., Walsh MJ., Wheat R., Blackbourn DJ., Wilson SA., Whitehouse A. a.whitehouse@leeds.ac.uk PLoS pathogens 2011 Only protein-protein interactions imex curation imex curation uif_human UAP56-interacting factor UIF FYTTD1 Forty-two-three domain-containing protein 1 protein protein human Homo sapiens Human MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG icp27_hhv8p mRNA export factor ICP27 homolog EB2 protein homolog ORF57 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MVQAMIDMDIMKGILEDSVSSSEFDESRDDETDAPTLEDEQLSEPAEPPADERIRGTQSAQGIPPPLGRIPKKSQGRSQLRSEIQFCSPLSRPRSPSPVNRYGKKIKFGTAGQNTRPPPEKRPRRRPRDRLQYGRTTRGGQCRAAPKRATRRPQVNCQRQDDDVRQGVSDAVKKLRLPASMIIDGESPRFDDSIIPRHHGACFNVFIPAPPSHVPEVFTDRDITALIRAGGKDDELINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKDIDIILDTAIFVCNAFVTRFRLLHLSCVFDKQSELALIKQVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISARGQELFRTLLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSAKFNKGLFFYPLS thoc4_human THO complex subunit 4 ALYREF ALY Ally of AML-1 and LEF-1 Aly/REF export factor BEF THOC4 Transcriptional coactivator Aly/REF bZIP-enhancing factor BEF protein protein human Homo sapiens Human MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS dx39b_human Spliceosome RNA helicase DDX39B UAP56 DDX39B DEAD box protein UAP56 56 kDa U2AF65-associated protein ATP-dependent RNA helicase p47 HLA-B-associated transcript 1 protein BAT1 protein protein human Homo sapiens Human MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR thoc5_human THO complex subunit 5 homolog THOC5 C22orf19 KIAA0983 Functional spliceosome-associated protein 79 NF2/meningioma region protein pK1.3 Placental protein 39.2 hTREX90 protein protein human Homo sapiens Human MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQDLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISKAEVTMGDPHQQTLARLDWELEQRKRLAEKYRECLSNKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQACDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVMLDLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR nxf1_human Nuclear RNA export factor 1 NXF1 TAP Tip-associating protein Tip-associated protein mRNA export factor TAP protein protein human Homo sapiens Human MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK icp27_hhv8p-fyttd1-1 3612804 N/A 3612810 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612811 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 1b, alyref-fyttd1-1 3612804 N/A 3612810 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612812 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 1c ORF57 was readily precipitated using the Flag-specific antibody in contrast to negative controls. Moreover, the observed interaction was still detected in the presence of RNase suggesting the interactions are not due to RNA bridging (Figure 1C) RNAse treatment inhibit interaction icp27_hhv8p-fyttd1-2 3612804 N/A 3612810 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 1c ORF57 was readily precipitated using the Flag-specific antibody in contrast to negative controls. Moreover, the observed interaction was still detected in the presence of RNase suggesting the interactions are not due to RNA bridging (Figure 1C) icp27_hhv8p-fyttd1-4 3612804 N/A 3612812 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612810 competitor competitor competitor neutral component neutral component over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612811 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 6b (i) icp27_hhv8p-alyref-1 3612804 N/A 3612812 competitor competitor competitor neutral component neutral component over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612810 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612811 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 6b (ii) fyttd1-icp27_hhv8p-1 3612805 N/A 3612810 unspecified role unspecified role prey prey cell lysate cell lysate Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3612811 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. ST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 1a(ii) ddx39b-fyttd1-1 3612805 N/A 3612810 unspecified role unspecified role prey prey cell lysate cell lysate Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3612813 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. ST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). physical association physical association false false false fig. 1a(ii) 1-135 3612805 N/A 3612811 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612810 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false fig. 5a icp27_hhv8p-fyttd1-3 3612805 N/A 3612810 ancillary ancillary ancillary ancillary purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612811 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612813 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig. 5b No interaction with GST or GST-UAP56 was observed in the presence of ORF57-6xHis alone. In contrast, an interaction between GST-UAP56 and ORF57 was observed in the presence of purified UIF-6xHis protein (Figure 5B), suggesting that UIF can facilitate the formation of the ORF57-hTREX complex. fyttd1-icp27_hhv8p-2 3612806 N/A 3612810 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3612811 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false fig. 2 In order to address potential overexpression artefacts of the above co-immunoprecipitation experiments and also determine whether ORF57 interacts with UIF during KSHV lytic replication, latently-infected BCBL-1 cells remained uninduced or reactivated using the phorbol ester, TPA. Lytic expression was confirmed by the detection of ORF57 using Western blot analysis in the reactivated samples (Figure 2). Uninduced and reactivated cell lysates were then incubated with no antibody control, ORF57- or UIF-specific antibodies. Reciprocal western blot analysis using the antibodies in reverse demonstrated that ORF57 interacts with UIF during KSHV lytic replication (Figure 2). Therefore, these data provide the first evidence of a viral protein associating with UIF. TPA treatment fyttd1-1 3612806 N/A 3612810 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3612811 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false fig. 2 In order to address potential overexpression artefacts of the above co-immunoprecipitation experiments and also determine whether ORF57 interacts with UIF during KSHV lytic replication, latently-infected BCBL-1 cells remained uninduced or reactivated using the phorbol ester, TPA. Lytic expression was confirmed by the detection of ORF57 using Western blot analysis in the reactivated samples (Figure 2). Uninduced and reactivated cell lysates were then incubated with no antibody control, ORF57- or UIF-specific antibodies. Reciprocal western blot analysis using the antibodies in reverse demonstrated that ORF57 interacts with UIF during KSHV lytic replication (Figure 2). Therefore, these data provide the first evidence of a viral protein associating with UIF. TPA treatment ddx39b-fyttd1-2 3612807 N/A 3612810 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig. 1b fyttd1-icp27_hhv8p-3 3612808 N/A 3612811 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed mCherry tag mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3612810 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false fig. 3b, 3d icp27_hhv8p-fyttd1-5 3612809 N/A 3612814 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3612813 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3612811 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ORF57PmutGFP contains site-directed alterations of two proline residues within a PxxP poly-proline motif, situated in the previously identified minimal Aly-binding domain encompassing residues 181–215. GST-pulldown experiments and co-immunoprecipitation experiments were performed as described above using GST-ORF57Pmut and pORF57PmutGFP, respectively. In both cases the mutant ORF57 protein, which fails to bind Aly, also lacks the ability to interact with UIF (Figure 1A and 1B). N/A 3612815 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false fig.7b (ii) results showed that expression of ORF57 in the wild type 293 cell line led to the precipitation of UAP56, FSAP79 and TAP suggesting that ORF57 expression leads to the formation of an export competent ribonucleoprotein particle (Figure 7B). Similar complex formation was observed in cell lines depleted singularly for Aly and UIF, where ORF57 can precipitate UAP56, FSAP79 and TAP (Figure 7B). In contrast, depletion of Aly and UIF in combination significantly reduced the interaction between ORF57 and the hTREX components and the nuclear export factor TAP. Importantly, these data demonstrate that either Aly or UIF are required for the formation of an ORF57-mediated nuclear export competent ribonucleoprotein particle.