IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hayashi-2009-5 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayashi YK., Matsuda C., Ogawa M., Goto K., Tominaga K., Mitsuhashi S., Park YE., Nonaka I., Hino-Fukuyo N., Haginoya K., Sugano H., Nishino I. Rare diseases - Interactions investigated in the context of Rare genetic disease hayasi_y@ncnp.go.jp The Journal of clinical investigation 2009 Only protein-protein interactions imex curation imex curation cav3_human Caveolin-3 CAV3 M-caveolin protein protein human Homo sapiens Human MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV cavn1_human Caveolae-associated protein 1 CAVIN1 Cavin-1 PTRF Polymerase I and transcript release factor FKSG13 protein protein human Homo sapiens Human MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI cav3-cavin1-1 3589666 N/A 3589667 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3589668 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q6NZI2:p.Glu176Argfs*99 NP_036364.2:p.Glu176Argfs*99 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6NZI2:p.Lys233Glnfs*192 NP_036364.2:p.Lys233Glnfs*192 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6c cav1-cavin1-1 3589666 N/A 3589669 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3589668 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q6NZI2:p.Glu176Argfs*99 NP_036364.2:p.Glu176Argfs*99 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6NZI2:p.Lys233Glnfs*192 NP_036364.2:p.Lys233Glnfs*192 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6d cav1-cavin1-2 3589666 N/A 3589669 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3589668 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q6NZI2:p.Glu176Argfs*99 NP_036364.2:p.Glu176Argfs*99 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6NZI2:p.Lys233Glnfs*192 NP_036364.2:p.Lys233Glnfs*192 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6d cav3-cavin1-2 3589666 N/A 3589667 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3589668 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell p.Glu176Argfs*99 NP_036364.2:p.Glu176Argfs*99 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p.Lys233Glnfs*192 NP_036364.2:p.Lys233Glnfs*192 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6c