IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mcdonald-1991-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McDonald NQ., Lapatto R., Murray-Rust J., Gunning J., Wlodawer A., Blundell TL. N/A Nature 1991 Only protein-protein interactions imex curation imex curation ngf_mouse Beta-nerve growth factor Ngf Ngfb protein protein mouse Mus musculus Mouse MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG ngf-3 3595700 N/A 3595701 unspecified role unspecified role neutral component neutral component purified purified Dimerization domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 N/A 3595701 unspecified role unspecified role neutral component neutral component purified purified Dimerization domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 3595706 3595704 direct interaction direct interaction false false false Fig.1a and b, Fig.2, Fig.3, Table 1 2.3A Rwork=0.22 Rfree=not available