IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ el-2000-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined El Ghouzzi V., Legeai-Mallet L., Aresta S., Benoist C., Munnich A., de Gunzburg J., Bonaventure J. Rare diseases - Interactions investigated in the context of Rare genetic disease The inserted amino acid sequence of TWIST mutant p.Pro139ins7 was taken from pmid: 11248247 bonavent@necker.fr Human molecular genetics 2000 Only protein-protein interactions imex curation imex curation el-2000-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie El Ghouzzi V., Legeai-Mallet L., Aresta S., Benoist C., Munnich A., de Gunzburg J., Bonaventure J. Rare diseases - Interactions investigated in the context of Rare genetic disease bonavent@necker.fr Human molecular genetics 2000 Only protein-protein interactions imex curation imex curation el-2000-3 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Ghouzzi V., Legeai-Mallet L., Aresta S., Benoist C., Munnich A., de Gunzburg J., Bonaventure J. Rare diseases - Interactions investigated in the context of Rare genetic disease bonavent@necker.fr Human molecular genetics 2000 Only protein-protein interactions imex curation imex curation el-2000-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining El Ghouzzi V., Legeai-Mallet L., Aresta S., Benoist C., Munnich A., de Gunzburg J., Bonaventure J. Rare diseases - Interactions investigated in the context of Rare genetic disease bonavent@necker.fr Human molecular genetics 2000 Only protein-protein interactions imex curation imex curation twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH p15923-1 Transcription factor E2-alpha PAN-2 TCF3 BHLHB21 E2A ITF1 Class B basic helix-loop-helix protein 21 Immunoglobulin enhancer-binding factor E12/E47 Immunoglobulin transcription factor 1 Kappa-E2-binding factor Transcription factor 3 Transcription factor ITF-1 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM tcf3-twist1-1 3636686 N/A 3636690 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q15672:p.Ala129Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Leu159Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Pro139_Ser140insLysIleIleProThrLeuPro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys145Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region Q15672:p.Tyr103* required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3636691 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Figure 2b, 2c p.Glu126* & p.Gln161* mutations of TWIST protein (uniprot: Q15672) also disrupt interaction with E12 bHLH protein (uniprot:P15923-1) tcf3-twist1-2 3636687 N/A 3636691 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bHLH domain required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) N/A 3636690 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bHLH domain required to bind necessary binding region required to bind range range range range false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Figure 2d tcf3-twist1-3 3636688 N/A 3636691 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A 3636690 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Figure 2e tcf3-twist1-4 3636689 N/A 3636691 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3636690 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Q15672:p.Ala129Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Leu159Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys145Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q15672:p.Pro139_Ser140insLysIleIleProThrLeuPro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Figure 3, 4a