MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint liu-2018-10 human-u87 Human U-87 MG glioblastoma cell line u87 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Oncogene 2018 Only protein-protein interactions imex curation imex curation liu-2018-13 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Oncogene 2018 Only protein-protein interactions imex curation imex curation liu-2018-11 human-u87 Human U-87 MG glioblastoma cell line u87 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Oncogene 2018 Only protein-protein interactions imex curation imex curation liu-2018-14 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Oncogene 2018 Only protein-protein interactions imex curation imex curation liu-2018-12 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C., Liu X., Bao Y., Meng W., Yang P., An Y., Ma J., Tang Y., Liu Z., Lu Y., Zhou J., Zhang Y., Feng J., Gao X., Su Z., Pu Y., He C. LXJ186517@126.com <LXJ186517@126.com>;chenghe@smmu.edu.cn <chenghe@smmu.edu.cn> Oncogene 2018 Only protein-protein interactions imex curation imex curation pebp1_human Phosphatidylethanolamine-binding protein 1 Prostatic-binding protein HCNPpp Neuropolypeptide h3 Raf kinase inhibitor protein PEBP1 PEBP PBP protein protein human Homo sapiens Human MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK tnr19_human Tumor necrosis factor receptor superfamily member 19 Toxicity and JNK inducer TRADE UNQ1888/PRO4333 TNFRSF19 TAJ TROY protein protein human Homo sapiens Human MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSICGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRLGSL phb_human Prohibitin PHB PHB1 protein protein human Homo sapiens Human MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ gdir1_human Rho GDP-dissociation inhibitor 1 Rho-GDI alpha ARHGDIA GDIA1 protein protein human Homo sapiens Human MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD tnr19_mouse Tumor necrosis factor receptor superfamily member 19 Tnfrsf19 Taj Troy TRADE Toxicity and JNK inducer protein protein mouse Mus musculus Mouse MALKVLPLHRTVLFAAILFLLHLACKVSCETGDCRQQEFKDRSGNCVLCKQCGPGMELSKECGFGYGEDAQCVPCRPHRFKEDWGFQKCKPCADCALVNRFQRANCSHTSDAVCGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCTSKVNLVKISSTVSSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDQPRLRHCAHRACCQYHRDSAPMYGPVHLIPSLCCEEARSSARAVLGCGLRSPTTLQERNPASVGDTMPAFFGSVSRSICAEFSDAWPLMQNPLGGDSSLCDSYPELTGEDTNSLNPENESAASLDSSGGQDLAGTAALESSGNVSESTDSPRHGDTGTVWEQTLAQDAQRTPSQGGWEDRENLNLAMPTAFQDA 1-128 3493516 N/A 3493521 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3a Moreover, in the lysates of the cultured U87 cells, the endogenous interactions of TROY with RKIP, prohibitin, or RhoGDIα were detected. The data suggest that TROY interacts with RKIP, prohibitin and RhoGDIα in glioma cells (Fig. 3a–f) pebp1-tnfrsf19-1 3493516 N/A 3493521 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3b tnfrsf19-pebp1-1 3493516 N/A 3493523 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3c phb-tnfrsf19-1 3493516 N/A 3493523 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3d F4a the FBS treatment did not affect the association of TROY with prohibitin or RhoGDIα. phb-tnfrsf19-2 3493516 N/A 3493524 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3e tnfrsf19-phb-1 3493516 N/A 3493524 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3f f4a the FBS treatment did not affect the association of TROY with prohibitin or RhoGDIα. tnfrsf19-pebp1-2 3493516 N/A 3493521 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3493522 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a we examined the interaction of TROY with RKIP, prohibitin, and RhoGDIα in glioma cells after FBS exposure. As shown in Fig. 4a–d, the interaction of TROY with RKIP was significantly enhanced after FBS exposure in the glioma cells. FBS pebp1-tnfrsf19-4 3493517 N/A 3493521 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4a pebp1-tnfrsf19-3 3493517 N/A 3493521 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4b tnfrsf19-pebp1-4 3493517 N/A 3493523 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4d tnfrsf19-phb-2 3493517 N/A 3493523 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4c phb-tnfrsf19-3 3493518 N/A 3493523 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3493522 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). pebp1-tnfrsf19-2 3493518 N/A 3493521 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3493522 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). arhgdia-tnfrsf19-1 3493518 N/A 3493524 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3493522 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3g We also examined if TROY and its binding-partners were co-localized in the glioma cells. TROY and the binding partners were observed to be co-expressed in the glioma cells through immunocytochemical staining (Fig. 3g). tnfrsf19-pebp1-5 3493519 N/A 3493521 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false sf4e tnfrsf19-pebp1-6 3493519 N/A 3493523 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3493525 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false sf4f tnfrsf19-pebp1-3 3493520 N/A 3493521 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3493525 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3493525 competitor competitor competitor unspecified role unspecified role purified purified tat tag tat tag transactivating tag Tat tag tat tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f5a f5c We further examined whether TROY (234–371 aa) could disrupt the interaction between TROY and RKIP. We prepared TROY (234–371 aa) protein tagged with TAT peptide. The GST-TROY-ICD and His-RKIP fusion proteins were incubated with the TAT protein (10 μM). Then, the GST pull-down assay was performed. RKIP bound to TROY was remarkably decreased when the TAT protein was applied (Fig. 5c, d), suggesting that the TAT-TROY (234–371 aa) protein can disrupt the interaction of TROY/RKIP in vitro.