DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ eubelen-2018-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-2 in vitro In vitro pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-4 in vitro In vitro force spectroscopy force spectroscopy intermolecular force predetermined predetermined participant predetermined Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-6 in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation eubelen-2018-7 danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Eubelen M., Bostaille N., Cabochette P., Gauquier A., Tebabi P., Dumitru AC., Koehler M., Gut P., Alsteens D., Stainier DYR., Garcia-Pino A., Vanhollebeke B. Benoit.Vanhollebeke@ulb.ac.be Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation reck_mouse Reversion-inducing cysteine-rich protein with Kazal motifs Reck protein protein mouse Mus musculus Mouse MASVRASPRSALLLLLAAAGVAEVTGGLAPGSAGAVCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREFCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRICEYNPVEVSMLTCLADVREPCQLGCTNLTYCTNFNNRPTELFRSCTAQSDQGAMSDMKLWEKGSIKMPFISIPVLDIKTCQPEMWKAVACSLQIKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEEHTAESICEFLSPADDLESCIPLDTYLRPSALGNIIEEVTHPCNPNPCPANELCEVNRKGCPSADPCLPYSCVQGCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFTIDCNVCSCFAGNLVCSTRLCLSEHSSDDDRRTFTGLPCNCADQFVPVCAQNGRTYPSACIARCVGLQDHQFEFGPCISKNPCNPNLCPKSQRCVPKPQVCLTTFDKFGCSQYECVPRQLTCDQARDPVCDTDHMEHSNLCTLYQRGKSLSYRGPCQPFCRAKEPVCGHNGETYSSVCAAYSDRVAVDYYGPCQAVGVLSEYSAVAECAAVKCPSLSAIGCKPIIPPGACCPLCAGMLRVLFDKEKLDTIAKVTSKKPITVVEILQKVRMHVSVPQCDVFGYLSIESEIVILIIPVDHYPKALQIEACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSLPSSAVVGRPLFHSLLLLLSLGLTVHLLWTRP wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK fzd5_mouse Frizzled-5 Fzd5 protein protein mouse Mus musculus Mouse MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV mint Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Plays a role in yolk sac angiogenesis and in placental vascularization. Binds to Wnt2, Wnt10B, Wnt5A, but not to Wnt2B or Wnt4 wnt7b_human Protein Wnt-7b WNT7B protein protein human Homo sapiens Human MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK dvl2_xenla Segment polarity protein dishevelled homolog DVL-2 dvl2 dsh DSH homolog 2 Xdsh protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAETKVIYHLDEEETPYLVKVPVPATDIRLRDFKAALGRGHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNDRVVSWLASSEGSQPDSAPPAPATEVRPEPPPPVPPPIPPPPAERTSGIGDSRPPSFHPNVSGSTEQLDQDNESVISMRRDRVRRRESSEQAGVGRGVNGRTERHLSGYESSSTLLTSEIETSICDSEEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQGYFTLPRNEPIHPIDPAAWVSHSAALSGSFPVYPGSASMSSMTSSTSVTETELSHALPPVSLFSLSVHTDLASVVKVMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFQDRREARKFASNLLKAGFIRHTVNKITFSEQCYYIFGDLTGCENYMTNLSLNDNDGSSGASDQDTLAPLPLPGASPWPLLPTFSYQYQAPHPYSTQPPAYHELSSYSYGMGSAGSQHSEGSRSSGSNRSDGGRGMQKDDRSGVAGVGGGDSKSGSGSESEYSTRSSIRRVGGGEAGPPSERSTSSRLPPHHPPSVHSYAAPGVPLSYNPMMLMMMPPPPLPPPGVCPPNSSVPPGAPPLVRDLASVPPELTATRQSFHMAMGNPSEFFVDVM a0a0u2ult4_danre protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSGPCVRIPFWVRVFLLLLLYRIAAGCPELFSSGCSCTEDRSKAHPTPGTRRKVSCGGKELTETPEVSLLPNRTVSLNLSNNRIRMLKNGSFAGLSSLEKLDLRNNLISTIMPGAFLGLTALRKLDLSSNRIGCLTPEMFQGLTNLTKLNISGNIFSSLDPNVFMELHSLKLVNFHSEFLSCDCGLRWVPSFFRSGSARLGDETLCACPRRLQNKPLRLLRESDLSCEGPLELHTLSLLPSQRQVVFKGDRLPFHCTASLVDKITALHWRQNGQPVTSDPTKGIHLEESVQHDCTFITSELILSNVHVEASGEWECVVPTGRGNTSCSVEIVVLENSASFCPEQKVNNNRGEFRWPRTLAGITSYQHCLQLRYPSLTLGGGVEQKKASRNCDRSGRWEEADYSQCLYTNDITRILHTFILMPVNASNAVTLAHQVRSYTLEAAGFTDTVDVLYVAQMMHKFMDYVTELRELSEVLVEMGSNLMQVDDQILARAQREERACSSIVYTLETLAWPQLHSHAQDLSRNSRNIVMEAHLIRPAHFTGISCTVYQRREGAAGSQVHDGADLSLEQQLRFRCTTGTHNTSLNAFHLKNAVALATVSLPATLFPPNAPPDCKLQFVAFRNGRFFPFTSNFTGHSDLARRRGISTPVIYAGLDGCSMWNQSDPIIVSLRHTSPGHDPVAAHWNSQALGHHGSWSLDGCQLIHSDVSISTLRCSVLSNYAVLQEIPDFPGSPSVPVEVLHPVIYTCTAVLLLCLFTIIITYILHHSSIRITRKSWHTLLNTSFHVAMTSAVFAGGITLTGYPIVCQAVGIVLHYSSLSTLLWIGVSARVIYKEALLRTPQQLEGESAVQPTQRPMLRFYLIAGGVPLIICGITAAVNINNYGDNIPYCWLVWQPSFGAFYIPAGLIILVTWIYFLCTVFCLRQRNFQESKDLQCSASDPSNLPESQPALSGSTSLLSTDSGVSPVHAGTTVEDQYSLKVQCLALMATQFVFVGLWCCGAMAVWHVDRERKLFSCLYGGTATGLGIFLVLHYCFKRLDVQAAWLGCCPGYHRSQPMPAYSHPCTVTVGVQSASERGSQLFVACHPPTDPNHYSSSARSSSTQSGTASITVAPCKLTNLLQVSQDNANNASRAPAGTNTNTSTSTENNKPTNNLLPSLLPVQQPQRRKACSRTKGGNTQYHHRGDARSHYRLKALRAGGGGSMGALGPSGTEHSNIYHVHKHASSENGSLRNSHSEGQNGLLTNGRHRGEGLATSPSEGSDGGSSGSRKPFPLLPSVARRAAMQQNAQCRSASKDNLKLAAAAERESKRSSFPLNMSSNVTATASLSTVSAPNGTLKGSVVELDTSGTDQSQGSVGMKSRVWKSETTV dvl2_human Segment polarity protein dishevelled homolog DVL-2 DSH homolog 2 DVL2 protein protein human Homo sapiens Human MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM fzd1_mouse Frizzled-1 Fzd1 protein protein mouse Mus musculus Mouse MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRADPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues mint reck-wnt7a-2 3472286 N/A 3472293 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed required to bind Delta CK4 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false required to bind Delta CK5 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 3472294 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 1d, Fig 2a fzd5-wnt7a-1 3472286 N/A 3472295 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3472294 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 1d reck-wnt7b-1 3472286 N/A 3472293 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3472296 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 1e reck-wnt7a-3 3472286 N/A 3472293 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3472294 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false required to bind required to bind required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false sufficient to bind N-terminal domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 2e, 2f reck-wnt7a-4 3472287 N/A 3472293 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Fc tag Fc tag fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3472294 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O00755:p.[Val241Ala;Phe251Ala;Leu252Ala;Lys262Ala] V241A/F251A/L252A/K262A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 3472287 Fig 3b reck-wnt7b-2 3472287 N/A 3472293 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed required to bind required to bind required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Fc tag Fc tag fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false required to bind required to bind required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3472296 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 3472287 Fig 3b reck-wnt7b-3 3472287 N/A 3472293 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed p.Met46_Phe93del 46-93 deletion mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Fc tag Fc tag fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false p.Cys113_Val150del 113-150 deletion mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false p.Asn160_Pro206del 160-206 deletion mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3472296 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Fig 3b a0a0u2ult4_danre-dvl2-2 3472288 N/A 3472297 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed GFP tag GFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3472298 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false required to bind required to bind required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 5J a0a0u2ult4_danre-dvl2-1 3472288 N/A 3472299 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3472298 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false required to bind required to bind required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig S17 reck-wnt7a-1 3472289 N/A 3472293 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3472294 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 1f reck-wnt7b-4 3472290 N/A 3472293 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Fc tag Fc tag fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3472296 antibody detection identification by antibody antibody detection unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 3472290 Fig 3c a0a0u2ult4_danre-dvl2-3 3472291 N/A 3472297 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed S35 label S35 label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3472298 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig S18 a0a0u2ult4_danre-fzd1-1 3472292 N/A 3472300 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-Venus tag C-Venus tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish N/A 3472298 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-Venus tag N-Venus tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish physical association physical association false false false Fig 6F