DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fernndez-2018-2 mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation fernndez-2018-1 mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation fernndez-2018-3 mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation fernndez-2018-4 mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation fernndez-2018-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation fernndez-2018-6 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B., Fernández ÁF., Sebti S., Wei Y., Zou Z., Shi M., McMillan KL., He C., Ting T., Liu Y., Chiang WC., Marciano DK., Schiattarella GG., Bhagat G., Moe OW., Hu MC., Levine B. ming-chang.hu@utsouthwestern.edu Nature 2018 imex curation Only protein-protein interactions imex curation bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bcl2-becn1-13 3465302 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey mutated gene mutated gene O88597:p.Phe121Ala p.Phe121Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 4a,b bcl2-becn1-18 3465302 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey native native physical association physical association false false false Fig 1a bcl2-becn1-12 3465303 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey native native physical association physical association false false false Fig 1a bcl2-becn1-14 3465304 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey native native physical association physical association false false false Fig 1a bcl2-becn1-15 3465305 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey native native physical association physical association false false false Fig 1a bcl2-becn1-16 3465306 N/A 3465310 unspecified role unspecified role prey prey native native N/A 3465311 unspecified role unspecified role bait bait native native physical association physical association false false false Extended Data Fig 5 bcl2-becn1-17 3465307 N/A 3465308 unspecified role unspecified role bait bait native native N/A 3465309 unspecified role unspecified role prey prey mutated gene mutated gene O88597:p.Phe121Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Extended Data Fig 3a