DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ srivastava-2018-1 yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Srivastava AP., Luo M., Zhou W., Symersky J., Bai D., Chambers MG., Faraldo-Gómez JD., Liao M., Mueller DM. david.mueller@rosalindfranklin.edu Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation atpd_yeast ATP synthase subunit delta, mitochondrial ATP16 YDL004W YD8119.03 D2935 F-ATPase delta subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRSIIGKSASRSLNFVAKRSYAEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits atpo_yeast ATP synthase subunit 5, mitochondrial Oligomycin sensitivity conferral protein ATP5 YDR298C OSCP D9740.11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNRVFTRSFASSLRAAASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDSI BD5F8EF4503E4D66 atpk_yeast ATP synthase subunit f, mitochondrial ATP17 D9481.21 YDR377W protein protein yeast Saccharomyces cerevisiae Baker's yeast MIFKRAVSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH atpg_yeast ATP synthase subunit gamma, mitochondrial ATP3 YBR039W YBR0408 F-ATPase gamma subunit ATP3a ATP3b protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRIVSNNATRSVMCHQAQVGILYKTNPVRTYATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG ADC71F3C1E0CDF91 atpf_yeast ATP synthase subunit 4, mitochondrial ATP4 LPF7C YPL078C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMSMGVRGLALRSVSKTLFSQGVRCPSMVIGARYMSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK BDBE0F6AD6E5392C atpb_yeast ATP synthase subunit beta, mitochondrial ATP2 J2041 YJR121W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLPRLYTATSRAAFKAAKQSAPLLSTSWKRCMASAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN EDFF256826F68F0C atpa_yeast ATP synthase subunit alpha, mitochondrial ATP1 YBL0827 YBL099W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLARTAAIRSLSRTLINSTKAARPAAAALASTRRLASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF E8041D289B924696 atp8_yeast ATP synthase protein 8 ATP8 AAP1 Q0080 A6L ATP-associated protein 1 F-ATPase subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL atp7_yeast ATP synthase subunit d, mitochondrial ATP7 YKL016C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM C6420CBEDF1BB45E atp6_yeast ATP synthase subunit a ATP6 OLI2 OLI4 PHO1 F-ATPase protein 6 Q0085 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNLLNTYITSPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH atp5e_yeast ATP synthase subunit epsilon, mitochondrial ATP15 P0345 YPL271W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK atp18_yeast ATP synthase subunit J, mitochondrial ATPase synthase I subunit YML081BC YML081C-A ATP18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD atp14_yeast ATP synthase subunit H, mitochondrial ATP14 L8003.20 YLR295C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFPIASRRILLNASVLPLRLCNRNFTTTRISYNVIQDLYLRELKDTKLAPSTLQDAEGNVKPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEETKESH atp9_yeast ATP synthase subunit 9, mitochondrial OLI1 ATP9 Lipid-binding protein OLI3 Oligomycin resistance protein 1 PHO2 Q0130 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV 82B4477D6F75D758 atp14-atp18-1 3440698 N/A 3440699 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440700 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440701 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440702 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440703 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440704 unspecified role unspecified role neutral component neutral component purified purified histag histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440705 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440706 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440707 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440708 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440709 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440710 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440711 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440712 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 physical association physical association false false false Figure 1 atp1-atp15-1 3440698 N/A 3440699 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440710 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440703 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440706 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440707 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 N/A 3440701 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast N/A 3440712 unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast Stoichiometry: 1.0 physical association physical association false false false Figure 1