IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ varnum-2017-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. split renilla luciferase complementation Split renilla luciferase complementation renilla luciferase renilla luciferase tag luciferase tag visualisation by luciferase assay tag luciferase Varnum MM., Clayton KA., Yoshii-Kitahara A., Yonemoto G., Koro L., Ikezu S., Ikezu T. Alzheimers - Interactions investigated in the context of Alzheimers disease tikezu@bu.edu The Journal of biological chemistry 2017 Only protein-protein interactions imex curation imex curation varnum-2017-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink antibody detection identification by antibody antibody detection Varnum MM., Clayton KA., Yoshii-Kitahara A., Yonemoto G., Koro L., Ikezu S., Ikezu T. Alzheimers - Interactions investigated in the context of Alzheimers disease Identification of the TREM2-TYROBP interaction was by sandwich ELISA. Cells were treated with the tyrosine phosphatase inhibitor sodium orthovanadate and cross-linker dimethyl 3,3′-dithiobispropionimidate (DTBP). tikezu@bu.edu The Journal of biological chemistry 2017 Only protein-protein interactions imex curation imex curation varnum-2017-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Varnum MM., Clayton KA., Yoshii-Kitahara A., Yonemoto G., Koro L., Ikezu S., Ikezu T. Alzheimers - Interactions investigated in the context of Alzheimers disease tikezu@bu.edu The Journal of biological chemistry 2017 Only protein-protein interactions imex curation imex curation tyobp_human TYRO protein tyrosine kinase-binding protein TYROBP DAP12 KARAP DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein human Homo sapiens Human MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK trem2_human Triggering receptor expressed on myeloid cells 2 TREM2 Triggering receptor expressed on monocytes 2 protein protein human Homo sapiens Human MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT trem2-tyrobp-1 3514476 N/A 3514479 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal renilla-n renilla-n c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3514480 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9NZC2:p.Thr66Met mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false c-terminal renilla-c renilla-c c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9NZC2:p.Arg47His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NZC2:p.Ser116Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2, 6 Supp. Fig. 1 TREM2-cross-linked antibody The TREM2 the Thr66Met mutation did not show enhanced luciferase activity on anti-TREM2 antibody stimulation trem2-tyrobp-2 3514477 N/A 3514479 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal renilla-n renilla-n c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3514480 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal renilla-c renilla-c c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 3 TREM2-cross-linked antibody trem2-tyrobp-3 3514478 N/A 3514479 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal renilla-n renilla-n c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3514480 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9NZC2:p.Ser116Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NZC2:p.Thr66Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false c-terminal renilla-c renilla-c c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9NZC2:p.Arg47His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Supp. Fig. 3A