UniProt UniProt http://www.uniprot.org szenasi-2017-2 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Alzheimers - Interactions investigated in the context of Alzheimers disease szenasi-2017-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Alzheimers - Interactions investigated in the context of Alzheimers disease szenasi-2017-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Alzheimers - Interactions investigated in the context of Alzheimers disease szenasi-2017-3 in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Szénási T., Oláh J., Szabó A., Szunyogh S., Láng A., Perczel A., Lehotzky A., Uversky VN., Ovádi J. Parkinsons - Interactions investigated in the context of Parkinsons disease Interaction involving tubulin could not be curated as this was purified from bovine bran therefore the protein content was unknown. ovadi.judit@ttk.mta.hu Biochimica et biophysica acta. Molecular basis of disease 2017 Only protein-protein interactions imex curation imex curation Alzheimers - Interactions investigated in the context of Alzheimers disease syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA tppp_human Tubulin polymerization-promoting protein TPPP TPPP1 25 kDa brain-specific protein TPPP/p25 p24 p25-alpha protein protein human Homo sapiens Human MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK snca-tppp-2 3525102 N/A 3525106 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) N/A 3525107 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3525102 Fig 4B tppp-snca-1 3525102 N/A 3525106 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3525107 unspecified role unspecified role bait bait purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 7A tppp-snca-2 3525102 N/A 3525107 competitor competitor competitor prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3525106 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3525107 unspecified role unspecified role bait bait purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 7 Multiple deletions are needed to eliminate the interaction of TPPP/p25 with SYN. snca-tppp-4 3525103 N/A 3525106 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3525107 unspecified role unspecified role neutral component neutral component purified purified n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 8B snca-tppp-5 3525103 N/A 3525107 competitor competitor competitor neutral component neutral component purified purified N/A 3525106 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3525107 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 8B/C snca-tppp-1 3525104 N/A 3525106 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3525107 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 3 snca-tppp-3 3525105 N/A 3525106 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3525107 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 4C