UniProt UniProt http://www.uniprot.org wang-2012-58 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Wang T., Leyh TS. tom.leyh@einstein.yu.edu The Journal of biological chemistry 2012 imex curation Only protein-protein interactions imex curation pyridoxal 5'-phosphate(2-) pyridoxal 5'-phosphate(2-) 3-hydroxy-5-(hydroxymethyl)-2-methylisonicotinaldehyde 5-phosphate dianion 3-hydroxy-5-(hydroxymethyl)-2-methylisonicotinaldehyde 5-phosphate(2-) pyridoxal 5'-phosphate pyridoxal 5'-phosphate dianion (4-formyl-5-hydroxy-6-methylpyridin-3-yl)methyl phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) NGVDGCNFYWLIFO-UHFFFAOYSA-L cyse_ecoli Serine acetyltransferase cysE b3607 JW3582 protein protein ecoli Escherichia coli (strain K12) MSCEELEIVWNNIKAEARTLADCEPMLASFYHATLLKHENLGSALSYMLANKLSSPIMPAIAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPDSDKPSMDMDQHFNGINHTFEYGDGI cysk_ecoli Cysteine synthase A O-acetylserine sulfhydrylase A O-acetylserine (thiol)-lyase A Sulfate starvation-induced protein 5 cysK cysZ b2414 JW2407 S-carboxymethylcysteine synthase protein protein ecoli Escherichia coli (strain K12) MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ 20ADDE911845AE72 o-acetyl-l-serine O-acetyl-L-serine L-Serine, acetate (ester) O-acetyl-L-serine O-Acetyl-L-serine O3-acetyl-L-serine O3-Acetyl-L-serine O-acetyl-L-serine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cyse-cysk-1 3473219 N/A 3473220 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3473221 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 3473222 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 3473231 3473226 direct interaction direct interaction false false false Fig. 1A, 2C, 3A, 6 cysk-pyridoxal 5'_phosphate(2_)-1 3473219 N/A 3473220 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3473222 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3473220 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3473222 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 3473236 3473234 3473240 3473238 direct interaction direct interaction false false false Fig. 1A, 2C cyse-cysk-2 3473219 N/A 3473220 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3473221 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3473222 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 1A, 2C, 5 cyse-cysk-3 3473219 N/A 3473223 allosteric effector allosteric effector unspecified role unspecified role N/A 3473220 cofactor cofactor coenzyme unspecified role unspecified role cysk binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3473221 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3473222 unspecified role unspecified role neutral component neutral component purified purified pyridoxal phosphate binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A, 2B, 3 The complex dissociates at OAS concentrations in excess of 50 um