IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ migueleti-2012-3 ecoli Escherichia coli (strain K12) pull down pull down anti tag western anti tag western blot anti tag western Migueleti DL., Smetana JH., Nunes HF., Kobarg J., Zanchin NI. Results from PP2A activity assays have not been added, as no purification after an initial IP was carried out, gels are not shown, so it is not possible to determine if contaminants were present. nilson.zanchin@pq.cnpq.br,jorg.kobarg@lnbio.org.br The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation migueleti-2012-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Migueleti DL., Smetana JH., Nunes HF., Kobarg J., Zanchin NI. Results from PP2A activity assays have not been added, as no purification after an initial IP was carried out, gels are not shown, so it is not possible to determine if contaminants were present. nilson.zanchin@pq.cnpq.br,jorg.kobarg@lnbio.org.br The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation migueleti-2012-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Migueleti DL., Smetana JH., Nunes HF., Kobarg J., Zanchin NI. Results from PP2A activity assays have not been added, as no purification after an initial IP was carried out, gels are not shown, so it is not possible to determine if contaminants were present. Results from PP2A activity assays have not been added, as no purification after an initial IP was carried out, gels are not shown, so it is not possible to determine if contaminants were present. nilson.zanchin@pq.cnpq.br,jorg.kobarg@lnbio.org.br The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation tiprl_human TIP41-like protein Putative MAPK-activating protein PM10 TIPRL Type 2A-interacting protein protein protein human Homo sapiens Human MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE p67775-1 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Replication protein C PP2Acalpha1 PPP2CA protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL p67775-2 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Replication protein C PP2Acalpha2 PPP2CA protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Catalytically inactive, shows enhanced binding to IGBP1, and does not interact with the scaffolding subunit PPP2R1A. ppme1_human Protein phosphatase methylesterase 1 PPME1 PME1 PP2593 PRO0750 protein protein human Homo sapiens Human MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC lcmt1_human Leucine carboxyl methyltransferase 1 Protein-leucine O-methyltransferase LCMT1 LCMT [Phosphatase 2A protein]-leucine-carboxy methyltransferase 1 CGI-68 protein protein human Homo sapiens Human MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKEITY 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA igbp1_human Immunoglobulin-binding protein 1 IGBP1 IBP1 CD79a-binding protein 1 B-cell signal transduction molecule alpha 4 Renal carcinoma antigen NY-REN-16 Protein phosphatase 2/4/6 regulatory subunit protein protein human Homo sapiens Human MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG ppp2ca-tiprl-2 3340631 N/A 3340634 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3340635 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5A PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-tiprl-3 3340631 N/A 3340634 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3340636 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5Ai PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-tiprl-4 3340631 N/A 3340637 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3340636 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5B PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-ppme1-1 3340631 N/A 3340637 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3340635 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5B-2 PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-ppme1-2 3340631 N/A 3340638 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3340636 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5C PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-lcmt1-1 3340631 N/A 3340638 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3340635 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 5C-2 PME-1, TIPRL, and LCMT-1 all bind to both PP2Aca isoforms. ppp2ca-1 3340632 N/A 3340637 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340639 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340634 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340640 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340635 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Figure 4C, 5G clone A4, C5. ppp2ca-igbp1-2 3340632 N/A 3340634 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340640 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3340636 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Figure 4C-2, 5G. clone 3.4 The interaction of PP2Aca2 with the PR65/A subunit was completely abolished, as was an interaction with PME1. ppp2ca-tiprl-5 3340633 N/A 3340640 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3340634 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3340635 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5F TIPRL was detected in association with the PP2Ac·a4 complex; however, neither PME-1 nor LCMT-1 were detected. ppp2ca-tiprl-6 3340633 N/A 3340640 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3340634 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3340636 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5E TIPRL was detected in association with the PP2Ac·a4 complex; however, neither PME-1 nor LCMT-1 were detected.