IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lei-2009-4 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-5 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-8 human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation lei-2009-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q., Lei NZ., Zhang XY., Chen HZ., Wang Y., Zhan YY., Zheng ZH., Shen YM., Wu Q. The TR3 protein has been inferred to be human according to the general context of the publication and because it corresponds to the sequence features reported in Fig. 1A. From ref 15964820 (Uta-Maria Bauer as coauthor) c-term Myc-PRMT1 and XGX mutant is reported to be human, XGX corresponds to S69A, G70A, and T71A and has been remapped to p.Ser97_Thr99delinsAlaAlaAla. From ref 15964820 (Dr Jörg Kobarg as coauthor) GST-PRMT1 and its deletion mutants are reported to be human. From 12529443 (Stéphane Richard) Myc-Sam68 is reported to be mouse. In Fig. 2B-C It was not possible to retrieve the seq of the NBRE probe, so results using this probe have not been annotated. Interactions with the following constructs have not been annotated, as the species origin is not supplied and the authors did not respond to a request for information:- HA-Src-2, His-PRMT1, Ha-PRMT1,H4, GAR and Flag-STAT3. qiaow@xmu.edu.cn Nucleic acids research 2009 imex curation Only protein-protein interactions imex curation nr4a1_human Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor HMR Early response protein NAK1 Orphan nuclear receptor TR3 ST-59 GFRP1 HMR NAK1 NR4A1 Nuclear hormone receptor NUR/77 Testicular receptor 3 protein protein human Homo sapiens Human MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF nurre_probe consensus TR3 response element (NurRE) probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GATCCGTGACCTTTATTCTCAAAGGTCA anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR ncoa2_human Nuclear receptor coactivator 2 NCOA2 TIF2 Transcriptional intermediary factor 2 BHLHE75 Class E basic helix-loop-helix protein 75 SRC2 protein protein human Homo sapiens Human MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC ccnd2_human_gene G1/S-specific cyclin D2 gene gene gene human Homo sapiens Human khdr1_mouse KH domain-containing, RNA-binding, signal transduction-associated protein 1 p21 Ras GTPase-activating protein-associated p62 GAP-associated tyrosine phosphoprotein p62 Src-associated in mitosis 68 kDa protein p68 Khdrbs1 protein protein mouse Mus musculus Mouse MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGGPRGGARASPATQPPPLLPPSTPGPDATVVGSAPTPLLPPSATAAVKMEPENKYLPELMAEKDSLDPSFTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVSVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGSITRGATVTRGVPPPPTVRGAPTPRARTAGIQRIPLPPTPAPETYEDYGYDDTYAEQSYEGYEGYYSQSQGESEYYDYGHGELQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY nurre_probe-nr4a1-1 3437445 N/A 3437453 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3437454 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig.2B, 2C nurre_probe-nr4a1-2 3437445 N/A 3437455 stimulator stimulator neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99873:p.Ser97_Thr99delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3437453 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3437454 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.2B, 2C nurre_probe-nr4a1-3 3437445 N/A 3437454 competitor competitor competitor neutral component neutral component purified purified in vitro In vitro N/A 3437453 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3437454 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.2B, 2C prmt1-nr4a1-1 3437446 N/A 3437455 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q99873:p.Ser97_Thr99delinsAlaAlaAla S69A, G70A, and T71A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3437453 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig.1 F, Fig.2A Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 prmt1-nr4a1-4 3437446 N/A 3437455 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3437453 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell engineered engineered ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3F Co-IP assays revealed that deletion of the C-terminus from TR3 (TR3/D2) abolished its binding to PRMT1 (Figure 2A, bottom), indicating that the C-terminus is a crucial region for TR3-PRMT1 interaction. Further mapping analysis demonstrated that LBD (aa 440–598) is the predominant PRMT1-binding region, although the DBD also showed a very weak interaction with PRMT1 prmt1-1 3437447 N/A 3437455 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3437453 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.1 G prmt1-nr4a1-3 3437447 N/A 3437456 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3437453 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.3E tr3-1 3437448 N/A 3437453 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3437454 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig.2B, 2C nurre_probe-nr4a1-4 3437448 N/A 3437453 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3437454 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 3C ccnd2-1 3437449 N/A 3437453 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3437457 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3B nr4a1-ccnd2_human_gene-1 3437449 N/A 3437455 stimulator stimulator neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q99873:p.Ser97_Thr99delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3437453 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3437457 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3B prmt1-tr3-1 3437450 N/A 3437453 unspecified role unspecified role prey prey partially purified partially purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3437455 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4E prmt1-nr4a1-5 3437450 N/A 3437455 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3437458 unspecified role unspecified role prey prey partially purified partially purified myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Supplementary Fig. I prmt1-nr4a1-6 3437451 N/A 3437455 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3437453 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.6A prmt1-khdrbs1-1 3437452 N/A 3437453 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3437458 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5H