IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jepson-2007-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Jepson BJ., Mohan S., Clarke TA., Gates AJ., Cole JA., Butler CS., Butt JN., Hemmings AM., Richardson DJ. a.hemmings@uea.ac.uk,d.richardson@uea.ac.uk The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation jepson-2007-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Jepson BJ., Mohan S., Clarke TA., Gates AJ., Cole JA., Butler CS., Butt JN., Hemmings AM., Richardson DJ. a.hemmings@uea.ac.uk,d.richardson@uea.ac.uk The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation tetra-mu3-sulfido-tetrairon tetra-mu(3)-sulfido-tetrairon (IRON/SULFUR CLUSTER) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) napb_ecoli Periplasmic nitrate reductase, electron transfer subunit Diheme cytochrome c NapB napB yejY b2203 JW5367 protein protein ecoli Escherichia coli (strain K12) MKSHDLKKALCQWTAMLALVVSGAVWAANGVDFSQSPEVSGTQEGAIRMPKEQDRMPLNYVNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVGNTFTPSKGYGK napa_ecoli Periplasmic nitrate reductase yojC yojD yojE napA b2206 JW2194 protein protein ecoli Escherichia coli (strain K12) MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAPCRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITWDQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVAVLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYADPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREVGTFAHRLPADMVVTNEKHRDICEKKWNIPSGTIPAKIGLHAVAQDRALKDGKLNVYWTMCTNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAERRTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEDLLAKKPELRGKTLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV mo(=o)-bis(molybdopterin guanine dinucleotide)(4-) Mo(=O)-bis(molybdopterin guanine dinucleotide)(4-) Mo(=O)-bis(molybdopterin guanine dinucleotide) tetraanion Mo-bis(molybdopterin guanine dinucleotide) molybdate-bis(molybdopterin guanine dinucleotide) tetraanion small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) napa-napb-3 3430314 N/A 3430316 unspecified role unspecified role neutral component neutral component N/A 3430317 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3430318 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3430314 Fig. 2B mo(=o)_bis(molybdopterin guanine dinucleotide)(4_)-napa-1 3430314 N/A 3430319 unspecified role unspecified role neutral component neutral component N/A 3430318 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3430314 Fig. 3B napa-tetra_mu3_sulfido_tetrairon-2 3430314 N/A 3430316 unspecified role unspecified role neutral component neutral component N/A 3430318 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3430314 Fig. 2A napa-napb-2 3430315 N/A 3430317 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3430318 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3430315 Fig. 1D, 1E