UniProt UniProt http://www.uniprot.org nakajima-2003-2 chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast gal4 vp16 complement gal4 vp16 complementation karyoplasmic interaction ion strategy KISS mammalian two hybrid gal4 vp16 complement predetermined predetermined participant predetermined Nakajima T., Fujino S., Nakanishi G., Kim YS., Jetten AM. jetten@niehs.nih.gov Nucleic acids research 2003 Only protein-protein interactions imex curation imex curation nakajima-2003-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nakajima T., Fujino S., Nakanishi G., Kim YS., Jetten AM. jetten@niehs.nih.gov Human testis cDNA Nucleic acids research 2003 Only protein-protein interactions imex curation imex curation nakajima-2003-3 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nakajima T., Fujino S., Nakanishi G., Kim YS., Jetten AM. jetten@niehs.nih.gov Human testis cDNA Nucleic acids research 2003 Only protein-protein interactions imex curation imex curation nakajima-2003-4 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nakajima T., Fujino S., Nakanishi G., Kim YS., Jetten AM. jetten@niehs.nih.gov Human testis cDNA Nucleic acids research 2003 Only protein-protein interactions imex curation imex curation nakajima-2003-5 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Nakajima T., Fujino S., Nakanishi G., Kim YS., Jetten AM. jetten@niehs.nih.gov Human testis cDNA Nucleic acids research 2003 Only protein-protein interactions imex curation imex curation jazf1_human Juxtaposed with another zinc finger protein 1 JAZF1 TAK1-interacting protein 27 TIP27 ZNF802 Zinc finger protein 802 protein protein human Homo sapiens Human MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ nr2c2_human Nuclear receptor subfamily 2 group C member 2 NR2C2 TAK1 TR4 Orphan nuclear receptor TR4 Testicular receptor 4 Orphan nuclear receptor TAK1 protein protein human Homo sapiens Human MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL jazf1-nr2c2-1 3466910 N/A 3466915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3466916 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P49116:p.Ile576Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3, 4 nr2c2-jazf1-3 3466910 N/A 3466915 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q86VZ6:p.Lys47Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q86VZ6:p.Tyr60Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q86VZ6:p.Leu76Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q86VZ6:p.Ala69Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3466916 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 5 nr2c2-jazf1-1 3466911 N/A 3466915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3466916 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false na nr2c2-jazf1-4 3466912 N/A 3466915 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3466916 unspecified role unspecified role prey prey partially purified partially purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 6B, 6C nr2c2-jazf1-5 3466913 N/A 3466915 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3466916 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6D nr2c2-jazf1-6 3466914 N/A 3466915 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3466916 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 7D