DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ magnaghi_jaulin-1998-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265136X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation magnaghi_jaulin-1998-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265141X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation magnaghi_jaulin-1998-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265137X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation magnaghi_jaulin-1998-4 in vitro In vitro pull down pull down autoradiography autoradiography Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265139X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation magnaghi_jaulin-1998-5 in vitro In vitro pull down pull down autoradiography autoradiography Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265138X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation magnaghi_jaulin-1998-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. DIP original experiment: DIP-265140X Nature 1998 IMEx Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Magnaghi-Jaulin L., Groisman R., Naguibneva I., Robin P., Lorain S., Le Villain JP., Troalen F., Trouche D., Harel-Bellan A. Only protein-protein interactions imex curation hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF hdac1-rb1-2 3293496 N/A 3293502 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3293503 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false e2f1-hdac1-2 3293497 N/A 3293504 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3293502 unspecified role unspecified role prey prey 414-418 Deletion 414-417 Deletion required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false rb1-hdac1-6 3293498 N/A 3293502 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3293503 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false rb1-hdac1-8 3293499 N/A 3293502 unspecified role unspecified role prey prey 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 414-418 Deletion 414-417 Deletion required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3293503 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rb1-hdac1-9 3293500 N/A 3293502 unspecified role unspecified role prey prey 35S Label 35S Label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3293503 unspecified role unspecified role bait bait P06400:p.Cys706Phe C706F Mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false hdac1-rb1-3 3293501 N/A 3293502 unspecified role unspecified role bait bait p.Ile414_Glu417del 414-417 Deletion mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3293503 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false