DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ di-1997-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Di Marco S., Priestle JP. DIP original experiment: DIP-263251X Structure (London, England : 1993) 1997 IMEx Structure of the complex of leech-derived tryptase inhibitor (LDTI) with trypsin and modeling of the LDTI-tryptase system. Di Marco S., Priestle JP. Only protein-protein interactions imex curation ldti_hirme Leech-derived tryptase inhibitor C protein protein medicinal leech Hirudo medicinalis KKVCACPKILKPVCGSDGRTYANSCIARCNGVSIKSEGSCPTGILN mint Acts as an inhibitor of human tryptase, trypsin and chymotrypsin. Probably acts to block host defense mechanisms tryp_pig Trypsin protein protein pig Sus scrofa (Pig) Pig FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN mint ldti_hirme-tryp_pig-1 3293364 N/A 3293365 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293366 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig direct interaction direct interaction false false false