DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huang-1997-2 rhoer Rhodococcus erythropolis Arthrobacter picolinophilus x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huang W., Jia J., Cummings J., Nelson M., Schneider G., Lindqvist Y. DIP original experiment: DIP-263249X Structure (London, England : 1993) 1997 IMEx Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold. Huang W., Jia J., Cummings J., Nelson M., Schneider G., Lindqvist Y. Only protein-protein interactions imex curation nhaa_rhoer Nitrile hydratase subunit alpha nthA protein protein rhoer Rhodococcus erythropolis Arthrobacter picolinophilus MSVTIDHTTENAAPAQAPVSDRAWALFRALDGKGLVPDGYVEGWKKTFEEDFSPRRGAELVARAWTDPEFRQLLLTDGTAAVAQYGYLGPQGEYIVAVEDTPTLKNVIVCSLCSCTAWPILGLPPTWYKSFEYRARVVREPRKVLSEMGTEIASDIEIRVYDTTAETRYMVLPQRPAGTEGWSQEQLQEIVTKDCLIGVAIPQVPTV nhab_rhoer Nitrile hydratase subunit beta nthB nha2 protein protein rhoer Rhodococcus erythropolis Arthrobacter picolinophilus MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA ntha-nthb-1 3293241 N/A 3293242 unspecified role unspecified role unspecified role unspecified role rhoer Rhodococcus erythropolis Arthrobacter picolinophilus N/A 3293243 unspecified role unspecified role unspecified role unspecified role rhoer Rhodococcus erythropolis Arthrobacter picolinophilus direct interaction direct interaction false false false