DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lupashin-1997-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268324X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268333X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268329X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lupashin VV., Waters MG. DIP original experiment: DIP-268325X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268334X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lupashin VV., Waters MG. DIP original experiment: DIP-268326X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268330X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268327X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268335X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268331X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268332X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268336X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation lupashin-1997-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lupashin VV., Waters MG. DIP original experiment: DIP-268328X Science (New York, N.Y.) 1997 IMEx t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Lupashin VV., Waters MG. Only protein-protein interactions imex curation sed5_yeast Integral membrane protein SED5 SED5 YLR026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIKDRTSEFQQSVLSYKKRNKNFREQQRERLQEKESENFANNTTGNGKSVSEFQKKASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQHSKNVVNLLNTQMKNISGSFKDVLEERQRLEMANKDRWQKLTTDTGHAPADDQTQSNHAADLTTYNNSNPFMTSLLDESSEKNNNSSNQGELSFPQNDSQLMLMEEGQLSNNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKYFDRIKSNRWLAAKVFFIIFVFFVIWVLVN B3192B57269A0B83 ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B sly1_yeast Protein SLY1 SLY1 YDR189W YD9395.22 YD9346.01 Suppressor of loss of YPT1 protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAVEEIASRKDISLRDMQISAILKMLFLNKDLNNNDNITTITDDIFNQQEIIWKVLILDIKSTATISSVLRVNDLLKAGITVHSLIKQDRSPLPDVPAIYFVSPTKENIDIIVNDLKSDKYSEFYINFTSSLPRNLLEDLAQQVSITGKSDKIKQVYDQYLDFIVTEPELFSLEISNAYLTLNDPKTTEEEITGLCANIADGLFNTVLTINSIPIIRAAKGGPAEIIAEKLGTKLRDFVINTNSSSTSTLQGNDSLERGVLIILDRNIDFASMFSHSWIYQCMVFDIFKLSRNTVTIPLESKENGTDNTTAKPLATKKYDIEPNDFFWMENSHLPFPEAAENVEAALNTYKEEAAEITRKTGVTNISDLDPNSNNDTVQIQEVVKKLPELTAKKNTIDTHMNIFAALLSQLESKSLDTFFEVEQDPGSTKTRSRFLDILKDGKTNNLEDKLRSFIVLYLTSTTGLPKDFVQNVENYFKENDYDINALKYVYKLREFMQLSNMSLQNKSLEDGSDSAFKPSNLTLSGIYGLTEGKLQGGVGSLISGIKKLLPEKKTIPITNVVDAIMDPLNSSQKNLETTDSYLYIDPKITRGSHTRKPKRQSYNKSLVFVVGGGNYLEYQNLQEWAHSQLHNPKKVMYGSTAITTPAEFLNEISRLGASNSSNNDA 79B0A1C4FB45042F sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 bet1_yeast Protein transport protein BET1 Suppressor of loss of YPT1 protein 12 BET1 SLY12 YIL004C YIA4C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEEQMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGISIKTWLIIFFMVGVLFFWVWIT DC1BD4FFE67E2217 sed5p-ypt1p-1 3293113 N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sed5p-sec22p-1 3293114 N/A 3293128 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293129 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sec22p-bet1p-1 3293115 N/A 3293130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sec22p-ypt1p-1 3293116 N/A 3293129 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3293127 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false sly1p-sed5p-1 3293117 N/A 3293128 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sed5p-ypt1p-2 3293118 N/A 3293126 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3293127 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false sec22p-bet1p-2 3293119 N/A 3293130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sed5p-bet1p-1 3293120 N/A 3293130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293129 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sec22p-sed5p-1 3293121 N/A 3293129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sec22p-sed5p-2 3293122 N/A 3293129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sed5p-sec22p-2 3293123 N/A 3293129 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sed5p-bet1p-2 3293124 N/A 3293130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293128 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sed5p-bet1p-3 3293125 N/A 3293130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293129 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293126 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false