DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ song-1996-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. DIP original experiment: DIP-262948X Science (New York, N.Y.) 1996 IMEx Structure of staphylococcal alpha-hemolysin, a heptameric transmembrane pore. Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. Only protein-protein interactions imex curation song-1996-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. DIP original experiment: DIP-262949X Science (New York, N.Y.) 1996 IMEx Structure of staphylococcal alpha-hemolysin, a heptameric transmembrane pore. Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. Only protein-protein interactions imex curation song-1996-5 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. DIP original experiment: DIP-262950X Science (New York, N.Y.) 1996 IMEx Structure of staphylococcal alpha-hemolysin, a heptameric transmembrane pore. Song L., Hobaugh MR., Shustak C., Cheley S., Bayley H., Gouaux JE. Only protein-protein interactions imex curation hla_staau Alpha-hemolysin hly hla Alpha-toxin protein protein staau Staphylococcus aureus MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN hly-4 3292881 N/A 3292884 unspecified role unspecified role unspecified role unspecified role staau Staphylococcus aureus direct interaction direct interaction false false false hly-5 3292882 N/A 3292884 unspecified role unspecified role unspecified role unspecified role staau Staphylococcus aureus direct interaction direct interaction false false false hly-6 3292883 N/A 3292884 unspecified role unspecified role unspecified role unspecified role staau Staphylococcus aureus direct interaction direct interaction false false false