DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cheah-1994-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cheah E., Carr PD., Suffolk PM., Vasudevan SG., Dixon NE., Ollis DL. DIP original experiment: DIP-263070X Structure (London, England : 1993) 1994 IMEx Structure of the Escherichia coli signal transducing protein PII. Cheah E., Carr PD., Suffolk PM., Vasudevan SG., Dixon NE., Ollis DL. Only protein-protein interactions imex curation glnb_ecoli Nitrogen regulatory protein P-II 1 glnB b2553 JW2537 protein protein ecoli Escherichia coli (strain K12) MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI glnb-4 3292601 N/A 3292602 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false