IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ saito-2017-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation saito-2017-6 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation saito-2017-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation saito-2017-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation saito-2017-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation saito-2017-5 human-293s Human 293S cell line Human 293s 293S cell line molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Cell reports 2017 Only protein-protein interactions imex curation imex curation egln_human Endoglin ENG END protein protein human Homo sapiens Human MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA q9uk05-pro_0000033903 Growth/differentiation factor 2 GDF2 BMP9 Bone morphogenetic protein 9 protein protein human Homo sapiens Human SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 320 429 acvl1_human Serine/threonine-protein kinase receptor R3 ACVRL1 ACVRLK1 ALK1 Activin receptor-like kinase 1 TGF-B superfamily receptor type I protein protein human Homo sapiens Human MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May bind activin as well mint homomint Defects in ACVRL1 are the cause of hereditary hemorrhagic telangiectasia type 2 (HHT2) [MIM:600376]; also known as Osler-Rendu-Weber syndrome 2 (ORW2). HHT2 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary, cerebral and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia eng-eng-2 3037790 N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR1_region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ZP_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 2.0 physical association physical association false false false Figure 4D-2, Supp 1C, Supp 5E BMP9 binds to His-mECTO in the presence and absence of ECTO-myc. eng-gdf2-5 3037790 N/A 3037798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed association association false false false Figure 5C MBP and other tags may be present on the ALK1 molecule but the exact vector used is not stated. acvrl1-eng-3 3037790 N/A 3037798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Figure 5C-2 MBP and other tags may be present on the ALK1 molecule but the exact vector used is not stated. eng-eng-3 3037790 N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P17813:p.Cys242Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false Supp Figure 1C eng-gdf2-6 3037791 N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3037797 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 direct interaction direct interaction false false false 3037791 Supp 8, table 1 eng-gdf2-7 3037791 N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3037797 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 direct interaction direct interaction false false false 3037791 Supp 8, table 1-2 eng-gdf2-8 3037791 N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17813:p.Phe282Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Ser278Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Gln270_Ile271delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 3037797 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 direct interaction direct interaction false false false 3037791 Supp 8, table 1-3 gdf2-1 3037792 N/A 3037797 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified human Homo sapiens Human Stoichiometry: 2.0 direct interaction direct interaction false false false Table S1 1.87A RFree = 0.233 RWork = 0.214 eng-gdf2-1 3037792 N/A 3037796 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293s Human 293S cell line Human 293s 293S cell line Stoichiometry: 2.0 N/A 3037797 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified human-293s Human 293S cell line Human 293s 293S cell line Stoichiometry: 2.0 direct interaction direct interaction false false false Table S1 4.45A RFree =0.318 RWork =0.286 eng-gdf2-3 3037793 N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed conditioned medium conditioned medium OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P17813:p.Asn268Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Met269Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Gln270Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Ile271Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Phe290Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Asp246Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P17813:p.Tyr277Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P17813:p.Gln270_Ile271delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P17813:p.[Asn268Ala;Gln270_Ile271delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P17813:p.Ser278Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P17813:p.Phe282Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed conditioned medium conditioned medium human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Figure 2E, Supp. fig. S4E, Supp 5E The isolated ZP region does not bind BMP9. eng-gdf2-9 3037793 N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed conditioned medium conditioned medium OR1_region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed conditioned medium conditioned medium human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 2.0 physical association physical association false false false Supp 3B eng-gdf2-2 3037794 N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3037797 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed Stoichiometry: 2.0 association association false false false Figure 2B Myc-MOR co-elutes with His-MOR only in the presence of BMP9 eng-eng-1 3037794 N/A 3037796 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4D The heterodimer forms in the presence and absence of BMP9. eng-gdf2-4 3037795 N/A 3037796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3037797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Figure 4E