DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zoued-2016-1 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268692X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-2 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268674X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-3 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268685X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-4 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268702X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-5 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268701X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-6 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268675X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-7 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268676X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-8 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268686X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268700X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-10 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268694X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268705X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-12 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268687X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-13 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268677X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-14 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268693X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-15 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268704X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-16 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268688X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-17 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268678X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-18 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268703X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-19 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268679X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-20 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268680X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-21 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268697X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-22 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268695X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-23 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268706X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-24 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268696X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-25 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268689X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-26 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268681X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-27 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268682X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-28 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268699X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-29 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268690X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-30 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268691X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-31 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268683X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-32 ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268684X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation zoued-2016-33 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. DIP original experiment: DIP-268698X Nature 2016 IMEx Priming and polymerization of a bacterial contractile tail structure. Zoued A., Durand E., Brunet YR., Spinelli S., Douzi B., Guzzo M., Flaugnatti N., Legrand P., Journet L., Fronzes R., Mignot T., Cambillau C., Cascales E. Only protein-protein interactions imex curation d3gux0_eco44 EC042_4539 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MNKLACLSGRFGRPGIVFIGVAALWWLITRYGAYLGAETRRDQILLLILLSLGVLFVCYLPVMKKYVQELTYRRRARKEQRLPDDEERLAQTPPRYVTVQDIRHTLRRQYGRFWGRKIRILLITGTASEVELLTPGLTEQFWQEEQGTLLLWGGDPSQPENADWLAALRRLRYRPADGIVWVTSGLSETLSAPLTEDALDRVSRAVSSCCERLGWRLPLYVWSLQESPDERGRITQPVGCLLPAECSSDKLKAQLQAMLPGLVAQGIQQICCAPRYYFLLSLAERFRRNIDAVVEPLSVLLRPYRQLLLAGIVFSPATVGGERSVRHRWRMDNRWEALPETVQQLPVRLQPSRTGHNWRRSLAVMAAILMMAQGTGMVVSFLANRSLVAEVQEQIRPAQNQQLSPAERLQALLNLQKSLARLQYREEHGAPWYLRAGMNQNADLLAVVMPLYAQNAHLLLRDAAAAHLEQQLRTFIRLPPDSPQRGKMAKAAYDQLRLYLMLAQPQHMEPAWFSRTLMREWPQRDGVSAVFWQANGPTLLAYYASGIITHPQWKLTADEELVSQSRTLLLRHLGTQNSDAMLYQKMLARVAHQFADMRLTDMTGDTDVSRLFFTDEVVPGMFTRQAWEEAVLPSIDTVINERREEMDWVLTDGRQKAPSPVSPEALRQRLTTRYFADFGNAWLNFLNSLHLRKAQTLSDVTEQLTLMADVRQSPLVALMNTLAVQGCTGQPREAVTDSLVKSARNLLSQEKQPVAVPESRLHGPLATTFGPVLALMDNQNNSADMLNLQTYLTRVTQVRLRLQQIAGSSDPQAMMQLLAQTVLQGKSVDLTDTRDYGSLTAAGLGQEWYGFGQTVFVRPMEQAWQQVLTPAAESLNARWRTAVVDGWNNAFSGRYPFKNVSSDASLPLLAKYLNTDTGRIARFLQNNLSGVLHREGSRWVPDTINTRGLTFNPAFLKAINTLSEIADVAFTTGNAGLHFELRPGTAAGVMQTTLITDNQKLIYVNQMPVWKRFTWPADTEAPGASLSWVSTQAGTRQYADLPGSWGLIRLLEMARRKAAPGVASGWSLSWQAQDGRMLNYTLRTEAGEGPLVLLKLRNFVLPETVFELSGTSAFTGNDEDAGDTVEETD d3gu40_eco44 EC042_4527 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MNKPVISRAEQIFYPGWLMVSQLRSGQPVEDGKALYRRACQLVKQAREELAEAGFSQKSSDIMLYAFCALLDESVLNREKTDDGWRTWQQDPLQAHFFGTLNAGEELWERIREQLKLPAPDVAVLTCLCRTLQLGFTGQYRSQDDERREDVIRALTARVPAFTFAQDAPVVVRAPGYRAGRTMYWLSWGAGIVTLAGLWCVLSSVLADQVARLTGQG d3gux5_eco44 EC042_4544 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MAIIAGKAGYGLIIALFSLSLSGCGLTQRVADGTVSATKSLFYRQIKTLHLDIRAREAINTSAAGIPLSVVVRIYQLKDNRSFDSADYQALFTGDNEILAGDIIAQKDVWLQPGGSVAVDMPLDDAAKFTGVAAMFLEPDQKKNTWRVVLGRDELEPDTPRLIEVSGNTLTLLPVKDK d3gux1_eco44 EC042_4540 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MASIHSLLSACQTTPRDVAEPAQVRIALWDKWLAPVTPDNPAGDDAGYDDDFQQMREEVNKLSGADAGIVSQLAEKLLTTRTKDIRVATWYIWARLRQDGEKGLADGLELLTGLLQRFGEHLHPQRSRARKAALEWLCSARILDSLSLYPEVVKADTLRIAGALWLAEQTFTDEASAPVLNGLYQALENRLMKAGGVDAVVPQEAAAPAPTVTSGSVMALSAITSGQELLSQARVLAKYLRDQPEGWLAAHRLMKSVRHDTLHQLPPLSADGRTRIAPPGPDRRASLKRLYLQQNWLSLLEQCDDMFARGASHLWLDLQWYIHQALLQTGKENYAAIIQYDLKGLLLRLPGLETLAFNDGMPFADDVTLSWIQQQVMECGERWAEEPSVTITAAPGDNDILSLEPEALQIADNEGTEAALSWLQARPGIQSDRSNWLLRLLMARVAEQTGKNDLALHLLAELDERATRLTLSQWEPELVFEVKARRLKLLRMKSAKTESDRVRLQPDMEHLLAGLIAIDAARAAVLCNSGSS d3guw0_eco44 EC042_4529 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYEKITWTYKDGNIIHSDAWSERTTA d3gux6_eco44 EC042_4545 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTAHQLMRVLSDVLLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRYVQT d3gu38_eco44 EC042_4525 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFMECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELLDLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHMPFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAHYLKIIQRENIGTTKDRRLLELELNNWIRGLVTEMTDPGDELQASHPLRDGKVVVEDIEDNPGFFRVKLYAVPHFQVEGMDVSLSLVSQMPKAKA d3gu37_eco44 EC042_4524 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MSSSFQNEIPKARVNLKLDLHTGGGQKKVELPLKLLVAGDFSNGQEERPLSERVKTDINKNNFNDVLADISPSVHLNVENTLAGDGSEESISLTFRNMNDFTPEQVARQIPRLKAMLAMRSLLRDLKANLLDNVTFRKELEKILRDPALSQTLRDELRALVPEKA d3gux4_eco44 EC042_4543 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MLEQSQPDQPPIGSGWQARQEAVRFCPYPGMGFPASEIKDAVIPEESHLPPIVHVTFMGLYGVTSPLPAHYISDIAQQREGHEAAADFLDIFSHRLITQYYRIWRKYSYPATFEAGGQDKTSQYLLGLARLGIPGCAQNIATPVSRFLALLPLMLLPGRTAEGLTSLVTLLAPGTQARVWHHDRRRIPLKTPLTMRVHHPVSLKSRPVMGDHATDVNGQVLLQLSTQTGSEVQGWLPGGHLYSDLLALLHVYLGSRLDVRLQLCVERSLLPDARLSCRPAAGSPQLGRTAVMRTQAKIATSAARVMTISLGRYQRVQEHYQRKETQENGDYRW d3gux3_eco44 EC042_4542 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MDDLTLRYFDAEMRYLREAGKAFAQAHPDRAAMLDLDKAGTPDPCVERLFEGFAFSMGRLRQKIDDDLPELTESLVSMLWPHYLRTIPSLSVVALTPRLSVMKMAETVPAGLEVTSRPVGPGNTVCRYRTTRAIPLNPLAVEKVVMTTEPDGRSVLKIGFACSELADWSQVDLHRLSLYLAAEAPVSSTLHLMMTKRLAALYLRLPGNDERIRIDGWFSPGGFAEEDRLWPKGDSAFSGYQLLLEYFTFREKFMFVHLNGLENVSLPAGISGFDLEVVLSQPWPADLPVTDDALCLHCVPVINLFTLEADPLIINGLESEYLLRPKRLQDGYTEIYSVDAVTGSGRTGSAEYVPFTSFRHRGGMLRHDAPERYYHTRVKRGVTGMYDTWLILGGQRWEADRMPERETLSLRITGTNGQLPRRALQSTLLDRCEQVLQAPVSVRNLCKPTLPVYPPTEDRFHWRVMSHLGTGFLNMLSSAEVLRGTLALYNWRDDELNHRRLDAILAVQHHRIQRFEKGFLLRGLDVEVTLDGNGFAGEGDIHLFGEMLNRFLALYADMNQFNQLTLIVQPEGKCIRWKENHNPRLPG d3guw4_eco44 EC042_4533 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MNLTDSLQNVLSGVGTLNRYRLDIPSCPSSLDVEDFSGTEGISKIYRYDIIFTSTDRYPDAAWFLRKSATLIMGTGLLESLTEQKKVHGVITDFRRISGSEDQAQYRITLKPFISLLDKQFRTHRFFVNKSVPEVVEQILTEHGLKGWEYEFSLKRTYPKREQINQYQESDLRFIQRLLAEVGIFYFFTLHPDAQTEVIHFGDVQAALIFDKTLPVNSPSGMSDSGTDSVWALNVEHRVVESRVITNDYNHREAQNILMSVPADMTRGEGYDTSYGEVYHYRPRHTERGDKIDPAPETANFWARLDHERFLAEQTRITGKSTDASLLPAQVLTITDSTPPVLPAPLQEPVLLTQLLFTGSRKSALQVMLSAVPYSEIVCWRPPLLTRPKITGTMTARVTSAKEGDIYAWQDASGMYRVKFDADRDDKNPGQESMPVRLAKPYSGDAYGFHFPLIQGTEVAIAFEEGDPDRPYIAHALHDSRHVDHVTDKNGTRNVIRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVDASRELRGEGAELRTDDWISIRGGKGIFISADMQPQAQGKMLDMDEAIRQLEQALSLARSMAKAATAANATQGDISCQQRLNASLTDLTAPGMLLHAPDGIGMVSARALRIASGSESVGIMSGDNTDITAGQSFTVVAEGAVSLLSRNQGMQLLAAKGRVNIQAQSDDLSMSSQQNLDIQSSEGKVTVSANQELILACGGAYIKLSGGNIELGCPGQILLKSTNMQKMGPTSLDIASVEMPRGFGGGFILTDEAGVPQPSTPYRLTTAEGDILQGITDENGKTAPVNTSIPSVVKVEFGKVKIHGETE d3gu39_eco44 EC042_4526 protein protein eco44 Escherichia coli O44:H18 (strain 042 / EAEC) MKIYRPLWEDGAFLMPQQFQQQAAWDVHLADSVARMGLAHPWGVVAAEFDDSLLPLSRLNATRLIVRFPDGTLIDTERADNLPPVCDLSTVSDRSLVDIVLALPLLNANGGNLDNGSESERPRRWKSERVNVQELAGHEQSEVAVLRHNLTLRMAHQENAAWLTCPVTRLVRDAQGQWCRDPRFIPPLLTLSASPSLMTELAELLHHLQARRQRLMSMRRENNARLADFAVADVSLFWLLNALNSAEPVLKELLDMPYRHPELLYRELARLAGSLLTFSLEHNVDAVPAYHHETPENVFPPLLSLLNRLLEASLPSRVVFIELKQKGVMWEGALHDARLREGADFWLSVRSSMPGHELQTKFPQLCKAGSPDDVSEVVNVALSGVIIRPVTHVPAAIPLRLENQYFALDLSTDAARAMLDAGRCTFYTPASLGDVKLELFAVLRT d3gu40_eco44-d3gux0_eco44-3 3289830 N/A 3289863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289864 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289865 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false d3guw0_eco44-d3gux1_eco44-1 3289831 N/A 3289866 unspecified role unspecified role prey prey Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gu38_eco44-d3gux6_eco44-1 3289832 N/A 3289868 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289869 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-1 3289833 N/A 3289866 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false d3gux1_eco44-2 3289834 N/A 3289866 unspecified role unspecified role unspecified role unspecified role Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false d3guw0_eco44-d3gu37_eco44-1 3289835 N/A 3289870 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3guw0_eco44-d3guw0_eco44-1 3289836 N/A 3289867 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gu38_eco44-d3gux4_eco44-1 3289837 N/A 3289871 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289869 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-3 3289838 N/A 3289866 unspecified role unspecified role unspecified role unspecified role Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false d3gux6_eco44-d3gux1_eco44-1 3289839 N/A 3289866 unspecified role unspecified role prey prey Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289868 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-4 3289840 N/A 3289866 unspecified role unspecified role unspecified role unspecified role Region 221-377 Region 221-377 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false d3gux5_eco44-d3gu40_eco44-2 3289841 N/A 3289863 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3289864 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3289865 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false d3guw0_eco44-d3gux3_eco44-1 3289842 N/A 3289872 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-d3gux1_eco44-1 3289843 N/A 3289866 unspecified role unspecified role bait bait Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-d3gux1_eco44-2 3289844 N/A 3289866 unspecified role unspecified role bait bait Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false d3gux5_eco44-d3gu40_eco44-3 3289845 N/A 3289863 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3289864 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3289865 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false d3guw0_eco44-d3guw4_eco44-1 3289846 N/A 3289873 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-5 3289847 N/A 3289866 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false d3gu37_eco44-d3guw0_eco44-1 3289848 N/A 3289870 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3289867 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false d3gu37_eco44-d3gu37_eco44-1 3289849 N/A 3289870 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289870 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3guw4_eco44-d3gux1_eco44-1 3289850 N/A 3289873 unspecified role unspecified role bait bait Region 1-490 Region 1-490 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false d3guw4_eco44-d3gux1_eco44-2 3289851 N/A 3289873 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false d3gux1_eco44-6 3289852 N/A 3289866 unspecified role unspecified role unspecified role unspecified role Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false d3gu39_eco44-d3gux1_eco44-1 3289853 N/A 3289874 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false d3gux5_eco44-d3gux0_eco44-1 3289854 N/A 3289863 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3289865 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3289866 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false d3gu37_eco44-d3gu38_eco44-1 3289855 N/A 3289869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289870 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gu38_eco44-d3gu37_eco44-1 3289856 N/A 3289869 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3289870 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false d3guw0_eco44-d3gux1_eco44-2 3289857 N/A 3289866 unspecified role unspecified role prey prey Region 393-532 Region 393-532 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289867 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false d3gu40_eco44-d3gux0_eco44-4 3289858 N/A 3289863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289864 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289865 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289866 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false d3gu40_eco44-d3gux0_eco44-5 3289859 N/A 3289863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289864 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289865 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289866 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false d3gu38_eco44-d3gu38_eco44-1 3289860 N/A 3289869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289869 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gu38_eco44-d3gux1_eco44-1 3289861 N/A 3289866 unspecified role unspecified role prey prey Region 1-392 Region 1-392 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289869 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false d3gux6_eco44-d3gux1_eco44-2 3289862 N/A 3289866 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3289868 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false