DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2016-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Yang K., Ren Z., Raushel FM., Zhang J. DIP original experiment: DIP-268478X Structure (London, England : 1993) 2016 IMEx Structures of the Carbon-Phosphorus Lyase Complex Reveal the Binding Mode of the NBD-like PhnK. Yang K., Ren Z., Raushel FM., Zhang J. Only protein-protein interactions imex curation yang-2016-6 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Yang K., Ren Z., Raushel FM., Zhang J. DIP original experiment: DIP-268481X Structure (London, England : 1993) 2016 IMEx Structures of the Carbon-Phosphorus Lyase Complex Reveal the Binding Mode of the NBD-like PhnK. Yang K., Ren Z., Raushel FM., Zhang J. Only protein-protein interactions imex curation yang-2016-7 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Yang K., Ren Z., Raushel FM., Zhang J. DIP original experiment: DIP-268480X Structure (London, England : 1993) 2016 IMEx Structures of the Carbon-Phosphorus Lyase Complex Reveal the Binding Mode of the NBD-like PhnK. Yang K., Ren Z., Raushel FM., Zhang J. Only protein-protein interactions imex curation yang-2016-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang K., Ren Z., Raushel FM., Zhang J. DIP original experiment: DIP-268479X Structure (London, England : 1993) 2016 IMEx Structures of the Carbon-Phosphorus Lyase Complex Reveal the Binding Mode of the NBD-like PhnK. Yang K., Ren Z., Raushel FM., Zhang J. Only protein-protein interactions imex curation phnk_ecoli Putative phosphonates utilization ATP-binding protein PhnK JW5727 b4097 phnK protein protein ecoli Escherichia coli (strain K12) MNQPLLSVNNLTHLYAPGKGFSDVSFDLWPGEVLGIVGESGSGKTTLLKSISARLTPQQGEIHYENRSLYAMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGGNIGERLMATGARHYGDIRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQGQVVESGLTDRVLDDPHHPYTQLLVSSVLQN phnj_ecoli Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase phnJ b4098 JW4059 protein protein ecoli Escherichia coli (strain K12) MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPMPYGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTERTDDATVIQTRHRIPETPLTEDQIIIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYEDIARFGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPPFTRVESLDFDDHPFTVQQWDEPCAICGSTHSYLDEVVLDDAGNRMFVCSDTDYCRQQSEAKNQ phni_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI Ribose 1-methylphosphonate 5-triphosphate synthase nucleosidase subunit JW4060 b4099 phnI protein protein ecoli Escherichia coli (strain K12) MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTGMRLERRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQGLAKFEEDSGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELGFAVNVGELLMTECEMVNGFIDPPGEPPHFTRGYGLVFGMSERKAMAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNHG phng_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG JW4062 b4101 phnG protein protein ecoli Escherichia coli (strain K12) MHADTATRQHWMSVLAHSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNASRVDFFTMVRGDNA phnh_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH JW4061 b4100 phnH protein protein ecoli Escherichia coli (strain K12) MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC phng-phnh-10 3287399 N/A 3287403 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3287404 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3287405 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3287406 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3287407 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false phng-phnh-11 3287400 N/A 3287404 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287405 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287406 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287407 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false phng-phnh-12 3287401 N/A 3287403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287404 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287405 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287406 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287407 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false phng-phnh-13 3287402 N/A 3287403 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287404 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287405 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287406 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3287407 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false