DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ muthusamy-2015-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267859X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267866X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267860X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267863X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267867X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-6 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267870X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267864X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267868X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-9 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267861X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-10 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267871X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267865X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267869X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation muthusamy-2015-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. DIP original experiment: DIP-267862X PLoS biology 2015 IMEx ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-β-Induced Smad Activation. Muthusamy BP., Budi EH., Katsuno Y., Lee MK., Smith SM., Mirza AM., Akhurst RJ., Derynck R. Only protein-protein interactions imex curation smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS tgfr1_mouse TGF-beta receptor type-1 Tgfbr1 Transforming growth factor-beta receptor type I ESK2 protein protein mouse Mus musculus Mouse MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM p98083-2 SHC-transforming protein 1 p52 Shc1 Shc ShcA SHC-transforming protein A Src homology 2 domain-containing-transforming protein C1 protein protein mouse Mus musculus Mouse MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMKPFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV Produced by alternative splicing. ap2b1_human AP-2 complex subunit beta AP2B1 CLAPB1 Beta-2-adaptin Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Adaptor protein complex AP-2 subunit beta ADTB2 Adaptor-related protein complex 2 subunit beta protein protein human Homo sapiens Human MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI ap2b1_mouse AP-2 complex subunit beta Beta-2-adaptin Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Adaptor protein complex AP-2 subunit beta Ap2b1 Clapb1 Adaptor-related protein complex 2 subunit beta protein protein mouse Mus musculus Mouse MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN tgfbr1-smad3-1 3287038 N/A 3287051 unspecified role unspecified role prey prey P84022:p.Asp408Glu D408E mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tgfbr1-smad3-2 3287039 N/A 3287051 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tgfbr1-shc1-4 3287040 N/A 3287053 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3287051 unspecified role unspecified role prey prey P84022:p.Asp408Glu D408E mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false tgfbr1-ap2b1-1 3287041 N/A 3287054 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tgfbr1-cav1-1 3287042 N/A 3287055 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287053 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false tgfbr1-ap2b1-2 3287043 N/A 3287056 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3287055 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3287052 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false tgfbr1-ap2b1-3 3287044 N/A 3287051 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287054 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false tgfbr1-cav1-2 3287045 N/A 3287055 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false smad3-tgfbr1-1 3287046 N/A 3287051 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3287052 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pRes pRes phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false tgfbr1-ap2b1-4 3287047 N/A 3287056 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3287052 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false tgfbr1-shc1-5 3287048 N/A 3287053 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false tgfbr1-cav1-3 3287049 N/A 3287055 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287051 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false tgfbr1-ap2b1-5 3287050 N/A 3287054 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3287053 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3287052 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false