DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mccullough-2015-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined McCullough J., Clippinger AK., Talledge N., Skowyra ML., Saunders MG., Naismith TV., Colf LA., Afonine P., Arthur C., Sundquist WI., Hanson PI., Frost A. DIP original experiment: DIP-268214X Science (New York, N.Y.) 2015 IMEx Structure and membrane remodeling activity of ESCRT-III helical polymers. McCullough J., Clippinger AK., Talledge N., Skowyra ML., Saunders MG., Naismith TV., Colf LA., Afonine P., Arthur C., Sundquist WI., Hanson PI., Frost A. Only protein-protein interactions imex curation mccullough-2015-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined McCullough J., Clippinger AK., Talledge N., Skowyra ML., Saunders MG., Naismith TV., Colf LA., Afonine P., Arthur C., Sundquist WI., Hanson PI., Frost A. DIP original experiment: DIP-268215X Science (New York, N.Y.) 2015 IMEx Structure and membrane remodeling activity of ESCRT-III helical polymers. McCullough J., Clippinger AK., Talledge N., Skowyra ML., Saunders MG., Naismith TV., Colf LA., Afonine P., Arthur C., Sundquist WI., Hanson PI., Frost A. Only protein-protein interactions imex curation chm1b_human Charged multivesicular body protein 1b CHMP1B C18orf2 Chromatin-modifying protein 1b CHMP1.5 Vacuolar protein sorting-associated protein 46-2 protein protein human Homo sapiens Human MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV p53990-4 IST1 homolog IST1 KIAA0174 Putative MAPK-activating protein PM28 protein protein human Homo sapiens Human MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKKT chmp1b-ist1-1 3286299 N/A 3286301 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286302 unspecified role unspecified role unspecified role unspecified role Region 1-189 Region 1-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false chmp1b-ist1-2 3286300 N/A 3286301 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286302 unspecified role unspecified role unspecified role unspecified role Region 1-189 Region 1-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false