DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pliotas-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. DIP original experiment: DIP-267977X Nature structural & molecular biology 2015 IMEx The role of lipids in mechanosensation. Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. Only protein-protein interactions imex curation pliotas-2015-2 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. DIP original experiment: DIP-267978X Nature structural & molecular biology 2015 IMEx The role of lipids in mechanosensation. Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. Only protein-protein interactions imex curation pliotas-2015-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. DIP original experiment: DIP-267979X Nature structural & molecular biology 2015 IMEx The role of lipids in mechanosensation. Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. Only protein-protein interactions imex curation pliotas-2015-4 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. DIP original experiment: DIP-267980X Nature structural & molecular biology 2015 IMEx The role of lipids in mechanosensation. Pliotas C., Dahl AC., Rasmussen T., Mahendran KR., Smith TK., Marius P., Gault J., Banda T., Rasmussen A., Miller S., Robinson CV., Bayley H., Sansom MS., Booth IR., Naismith JH. Only protein-protein interactions imex curation mscs_ecoli Small-conductance mechanosensitive channel yggB mscS b2924 JW2891 protein protein ecoli Escherichia coli (strain K12) MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA mscs-1 3285701 N/A 3285705 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mscs-2 3285702 N/A 3285705 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mscs-3 3285703 N/A 3285705 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mscs-4 3285704 N/A 3285705 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false