DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dou-2015-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267176X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267165X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267181X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267169X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267172X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-6 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267177X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267166X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267170X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267180X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-10 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267173X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-11 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267167X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267178X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267174X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-14 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267168X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267175X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-16 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267179X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-17 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267182X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation dou-2015-18 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267171X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions imex curation lmnb1_human Lamin-B1 LMNB1 LMN2 LMNB protein protein human Homo sapiens Human MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV mlp3c_human Microtubule-associated proteins 1A/1B light chain 3C MAP1LC3C Microtubule-associated protein 1 light chain 3 gamma MAP1A/MAP1B light chain 3 C MAP1 light chain 3-like protein 3 Autophagy-related protein LC3 C Autophagy-related ubiquitin-like modifier LC3 C protein protein human Homo sapiens Human MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL q9h492-1 Microtubule-associated proteins 1A/1B light chain 3A MAP1LC3A Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1 light chain 3-like protein 1 MAP1A/MAP1B light chain 3 A Microtubule-associated protein 1 light chain 3 alpha protein protein human Homo sapiens Human MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM lmnb2_human Lamin-B2 LMNB2 LMN2 protein protein human Homo sapiens Human MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL map1lc3b-lmnb1-1 3285453 N/A 3285471 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false map1lc3b-lmnb1-2 3285454 N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false map1lc3c-lmnb1-1 3285455 N/A 3285473 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false map1lc3b-lmnb1-3 3285456 N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9GZQ8:p.Gly120Ala G120A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false map1lc3b-lmnb1-4 3285457 N/A 3285474 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285471 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false map1lc3b-lmnb1-5 3285458 N/A 3285471 unspecified role unspecified role prey prey Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3285472 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false map1lc3b-lmnb1-6 3285459 N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-28 Region 1-28 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false map1lc3b-lmnb1-7 3285460 N/A 3285471 unspecified role unspecified role prey prey Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P20700:p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala] S393A/S395A/S396A/R397A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P20700:p.Val398Ala V398A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P20700:p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala;Val398Ala] S393A/S395A/S396A/R397A/V398A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P20700:p.[Ser395Ala;Ser396Ala] S395A/S396A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P20700:p.[Ser396Ala;Arg397Ala] S396A/R397A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P20700:p.[Ser393Ala;Ser395Ala] S393A/S395A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3285472 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false map1lc3a-lmnb1-1 3285461 N/A 3285475 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false lmnb1-map1lc3b-1 3285462 N/A 3285471 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3285472 unspecified role unspecified role unspecified role unspecified role Q9GZQ8:p.Gly120Ala G120A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false map1lc3b-lmnb1-8 3285463 N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false lmnb1-lmna-1 3285464 N/A 3285476 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285471 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false map1lc3b-lmnb1-9 3285465 N/A 3285471 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false lmnb1-lmna-2 3285466 N/A 3285477 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285476 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285471 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3285472 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false map1lc3b-lmnb1-10 3285467 N/A 3285471 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false map1lc3b-lmnb1-11 3285468 N/A 3285471 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false gabarap-lmnb1-1 3285469 N/A 3285478 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false map1lc3b-lmnb1-12 3285470 N/A 3285474 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285471 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3285472 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false