DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yan-2015-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. DIP original experiment: DIP-267205X Nature 2015 IMEx Endoperoxide formation by an α-ketoglutarate-dependent mononuclear non-haem iron enzyme. Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. Only protein-protein interactions imex curation yan-2015-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. DIP original experiment: DIP-267206X Nature 2015 IMEx Endoperoxide formation by an α-ketoglutarate-dependent mononuclear non-haem iron enzyme. Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. Only protein-protein interactions imex curation yan-2015-5 in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. DIP original experiment: DIP-267207X Nature 2015 IMEx Endoperoxide formation by an α-ketoglutarate-dependent mononuclear non-haem iron enzyme. Yan W., Song H., Song F., Guo Y., Wu CH., Sae Her A., Pu Y., Wang S., Naowarojna N., Weitz A., Hendrich MP., Costello CE., Zhang L., Liu P., Zhang YJ. Only protein-protein interactions imex curation ftmf_aspfu Verruculogen synthase ftmOx1 ftmF AFUA_8G00230 Fumitremorgin biosynthesis protein F protein protein aspfu Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) Aspergillus fumigatus MTVDSKPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSPA ftmox1-1 3285442 N/A 3285445 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftmox1-2 3285443 N/A 3285445 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftmox1-3 3285444 N/A 3285445 putative self putative self unspecified role unspecified role Y224 Y224 hytyr hydroxylated tyrosine HyTyr modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation false false false