DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bacaj-2015-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266586X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions imex curation bacaj-2015-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266588X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions imex curation bacaj-2015-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266589X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions imex curation bacaj-2015-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. DIP original experiment: DIP-266587X PLoS biology 2015 IMEx Synaptotagmin-1 and -7 Are Redundantly Essential for Maintaining the Capacity of the Readily-Releasable Pool of Synaptic Vesicles. Bacaj T., Wu D., Burré J., Malenka RC., Liu X., Südhof TC. Only protein-protein interactions imex curation syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG syt7_rat Synaptotagmin-7 Syt7 Protein Syt7 Synaptotagmin VII protein protein rat Rattus norvegicus (Rat) Rat MYRDPEAASPGAPTRDVLLVSAIITVSLSVTIVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRGEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA stx1a-syt1-2 3284564 N/A 3284568 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3284569 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3284570 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false stx1a-syt1-3 3284565 N/A 3284568 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P21707:p.[Asp178Ala;Asp230Ala;Asp232Ala;Asp309Ala;Asp363Ala;Asp365Ala] D178A/D230A/D232A/D309A/D363A/D365A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3284570 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false stx1a-syt7-1 3284566 N/A 3284571 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q62747:p.[Asp225Ala;Asp227Ala;Asp233Ala;Asp357Ala;Asp359Ala] D225A/D227A/D233A/D357A/D359A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3284570 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false stx1a-syt7-2 3284567 N/A 3284571 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3284569 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3284570 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false