DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fischer-2015-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267937X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267925X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267943X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267953X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267936X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-6 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267948X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast light scattering light scattering predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267932X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-8 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267926X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267939X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267952X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-11 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267944X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-12 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267933X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267938X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-14 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267947X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-15 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267955X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-16 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267927X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-17 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267928X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-18 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267941X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-19 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267951X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-20 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267945X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-21 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267929X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-22 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267934X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-23 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267940X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-24 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267935X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-25 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267942X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-26 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267954X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-27 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267930X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-28 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267949X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-29 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267946X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267931X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation fischer-2015-31 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. DIP original experiment: DIP-267950X Nature structural & molecular biology 2015 IMEx Linker Nups connect the nuclear pore complex inner ring with the outer ring and transport channel. Fischer J., Teimer R., Amlacher S., Kunze R., Hurt E. Only protein-protein interactions imex curation nu145_yeast Nucleoporin NUP145 YGL092W NUP145 RAT10 Nuclear pore protein NUP145 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNKSVNSGFTFGNQNTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKSAGSLFGNNNATANSTGSTGLFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSNNTQSSTGIFGQKPGASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMAVADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRLKATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAPNENSIFPQNGFNFLSSQRADLTELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSENEPIANADSVTNIDRKENRDNNLDNTYLNGKEQSNNLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEVILKTDGTFGTLSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 59399D86BB553030 nu192_yeast Nucleoporin NUP192 NUP192 YJL039C Nuclear pore protein NUP192 J1216 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKWSAIPFQTLYRSIESGEFDFDLFKEVLPDLQNLNLNTDKLKNNASRSQLEKGEIELSDGSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTANNGKVQYFLRRQYILQIVSFIVNCFHEDTELYQELIKNGALVSNILSAFKFIHTQLSEIKQQINKAQILENYNALFQQNIKFRRDFLLREYDILSQILYGLVDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHLFASLRVLPDADVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTMDFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLERHIPRLIPKQLLDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMSTTGTARLNSMPNNVNEYSYTTIVLSDQTQEFFLSSFDDVLQTIITDCAFLLTKIKDAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSCTFWSDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENALNVYHYFGENSSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEGLNEEAVIFLSSLLTLVGSVTYQVDEDVKSSLSKVFSDVLFEFTKINTPLVGAAFKVISNLVPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVLTKYSDVLGFLQLFHNLISIHSRENNSEYMVFGKLAFPTRLGQGYRKVGIWPYFDYIFNDILAHVDQIVDIRNKRAVQLPILKIIYTGLCSFDYSVILNSIPAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSIFNVVDVGVDQLSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFLPKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSERSNGSVASLSKRNKLLTIFDSVDESARIKDAFITQLESSITDAGVLALKLELLDFLTSNLSNYSRTMTISHLLLGFQVSNVISLGPNLATFISSGTSLLDSLISVLEASLNSITKDNIDYAPMRLATAALEIILKLCRNPLTSGLLYSYLIKENFFERIMILDPQVTRFTTWNGSPFDNSTEEKCKNFIESESVGAFLSFLAYRNYWTQYLGLFIHKISFSGTKSEVLTYVNYLISNTMYSVRLFSFLDPLNYGNICEPKETLSIFTNVPLNLEQVTLNKYCSGNIYDFHKMENLMRLIKRVRAESLHSNSFSLTVSKEQFLKDADVECIKAKSHFTNIISRNKALELNLSVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIPKISDYIEFNITFSEELVSLAVFLFDIYNRDRKLITDKGTVDGRLYQLFKTCIQGINSPLSSVALRSDFYILANHYLSRVLSDQVGSEKVLQDLRLGSKKLVEIIWNDVVYGEGTSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTDALLNSTTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAELSFLKVDPDLGLDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFELIVPIFQLISAVLVSMGSSNKAVVQTVKGLLNTYKRLVIGIFKRDLLREKEDKKNSSDPNNQSLNEMVKLIVMLCTLTGYQNND FD2D61FDEA5451C4 nu170_chatd Nucleoporin NUP170 NUP170 Nuclear pore protein NUP170 CTHT_0036270 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MEPMTPMRPIPGAYVNTPAPPTANPARRRLFTEASSSGAAATTQLGAAPAPLASTMAPGPEINSGLMTPQAREDLPPVAKAAQVVNQTLQLDDSYPDLDSYCRPGASSDYEMQSSDSSWAPFHVVRHHNIPDKVFEHLNAGEVFTKLGLFAEIGYAWASIDSSLFLWDYTHPNPELIGYEEATHTITAVALVPPKPGVFVKTITHVLVVATTSEIILLGVSATPTPSGSKSLTLYSTRMSVHRGGSDVSFIVGTKDGRIFLGGESDTDIHEIFYQQEERWFSSRCGKINHSHPGWSAVVPSLAGLPFGSRQQEWLRGLYVDDTRNLLYSLSNRSTIRTYHMEGPEKLTKVIEKDKTSCLRDFAHMADSSPLFTDKTNIVALSPIPATEASKLHLMALTDTGCRLFLSATSSASYTMGGATSLAPQSMQLQFVKFPPRESPTRIRTLNGQIIDSQLDKTSRALDPSALGFRFSPGYFFDVVRKHPNQDMLFVSAPDTGRIKVTQPASALKYFEQGTWIELENGNRTIEIGLTTAPFAAAKQPLGFGNELAVQFDQVPGEFAVLTNTGVHIVRRRRLVDIFAKALGNCVSASDDALEREVRKFINQYGRVETIAAALAVACGQGSDLRTGTGRGMDRNTENLARAAFIEYGGQPRLAESDGKQSVSESVRLSSRHDALALYLTRLVRTLWKAKVVQVGSGSDISSTIPTSKLVTIQENVERLRNFLEANKSTIQGLAPPSERLFGRQEDIANQKEHQALHALQKLMESISEGISFVLMLFDERVSDIYARLDAVSQQQLKDLTYEQLFSQTPGKELAKVLVKAIVNRNIASGANVETVADALRRRCGSFCSPDDVVTFKAQEQLQRASEQAHNSPVLRALLAESLRLFEQVAGSLTPANLTTAVEQYISLKYYAGAIQLCLTVAQQKDRGNTALSWVNDGKPANDSRKKAFDERKICYNLIHQVLDKLESDFAGEPELVDGRPTLAATKRMEAYNVVNDSSDEVFHFDLYEWYIEKGWTDRILSIDSPHVITYLQRLAETDFRHAELLCRFYTTRSRFFEAAQVQTNLAKSDLNISLKDRIILLSRAKGNASVNTIGISRQQQQQLNHEASELLEIAHIQDDLLERLVADPRIPEERKAEIEEFLDGPIRTLTDLFNDYADQANYYDLCLLIFHAADFHNPRTILDTWNNLINQSHFEAEQRREYWEIVQAGGDLPAGVIAPIAEPPLPYVYVSQQIQLIAHRTSLDSLIFPVNSLLPVVCAYAINNGQDASIGADPCWPIQLFLNLGVPHALVVQVLENVLDTQEAPFTGRRRKLVVQWIAMAVDMWVREVERRGAMAAAAASGASGSEAVMGSWVSELLGRADQVLTQIAGTGATLRGGAASDAEEIASLRRTVKGLKRSVDMLLGGEMARMSFFR nic96_chatd Nucleoporin NIC96 Nuclear pore protein NIC96 CTHT_0008480 NIC96 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSLIGNGPSVPPSSTKASLFSSPTTSANPTGGLFGSTTGGSSLFAPKTAGSTTTSTTQPTSTTGLGTSLFGTSTTANTQNTANAARPSLFTAGNSIFGTSTTQPGLGASSLTTAATSNQQAQQQQQQRQQHQQAAPTGALFDSLLARNKKQAEGETALGELPSLQLGLADLRQRLRKLGPSSDRPIEPGKAHYFLAASGVDPGAAVRDLGALGLQAKTERTAASVGPAAGPSGVSTTGFGTGLGEVDVDTYLSNLQTKTTLSMIADGLERSARDFDAFLEENVTLEWEAQRKRIYQHFGIKPRDSSVAGTTTAQPTATPSKDGQGTFGRSRRKASQPPPGERPAQRMSILGRSTMMRSVIGTPTRIGAHAPEFSDVEARKDSSGAAVASVDDRFLREKQAKLAEKIREFNDARQRGTPFYICRDLADLESKSGDRHGPHIVEAYRAVMEMVGEHPDAGEAPRERQFAKMYLDPNTQSANALAMRKQILKGATTFLEKQFWNEVNSLIAKYPQDANLGGLPDVVSKIKAYIRLRIARKTLVPDNVELQQINGEYVWAIVFYLLRAGFVTEAAQYVNSNQAHFRAIDRTFSGYINSYASSEERRLKRQMQDRCMSEYNQRIRNAPEGSIDPFRMACYKIIGRCDLSNRSLDGLQTDVNDWIWLQFNLARETDRSLELAGESYGLAELQASIREIGLKHFPKTAAEDTNGSFGMFFYLQILAGMFEQAIAYLYPFSYVDAVHFAIALTYYGLLRPVDAASAGNELLSHNTRSMPQINFGRMLGYYTRDFRAANPAAAVDYLVLICLNADEAAGGQQAQAALCHEALRELVLESREFSRLIGDIRPDGRRIRGVIEERGPLIALGQEDDFIRTITLQAASFADDNGRTTDAVLLYHLAEDYDTVVSIVSRALSEAISLEIGEDPMRLIPVKPRVTNAEGQVEEAAPGSSLSLAAIDDPVELAKAMMGMYERDHMFWQKIREPNRVACSVLLQMADIKSLVEQGRWAECLDKIRALDILPLTARGDPGTIRSYAARFPSLAQPVAINVPNLLMWTVLCCMRQRERLAGGQFAGNESTARLMMDELKQMTVDLMAYTSQLRYRLPPHLHEALARASAD nu192_chatd Nucleoporin NUP192 Nuclear pore protein NUP192 CTHT_0023410 NUP192 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MTDLRKLEALQALHAELVAVRQHRFEGLQVLETLLEEQTDAFKALIAKPARDTKDREALGKEPKKLKIGEEEYSLNEDFVNDCLKLADELDLNEKESARILIDCDAEGDVETQSRPLWECGVIRFHQERKYLLDCMRLILEIAADEDIDAGLQESFGVAAEDKIFGIPPPWERNKENQPTQVKKFIPRCMEAMKGVRSMLQCMADKANARNMLQQASLVRPLDNQETLDFSRLSLVEQHECLASILHAAVQRHHATIADFQDFIKILRKWDKYDHFLIHLIPVLAAYITEFGSPEGMGDLQQARRLNDFICKGGDEDSWALPVLGAAVRAWWIAEHNGFYLDDTVQDLRGINLDEEDEQRTKQFLDALKEGAFDFILSVAADCKAQEWQDPSQLGARQWLQRKIPSLPSEPFPFSHFLQHSLMVHLEGFVDATISNLPDVLRKLRTEEDEQRQLRPNHEQDMDLERFLIIISYAYEGRPDAAMSFWEDPDSNLAGFLQWASRRASTPLVSAFCEMLRCLADNEECATAAHNFLLDEGHQASGKMKRSQSLTWSQIFKELEYFTTKVCSERPNPPQASMHRPGRPGADPAEIEPESALMLECYLRLIAKLATESEIARKRLIMDEDFNLVDTILKLSVGVIPHRLRACIFYVLKALMIRKTHEELDAMWRWVEAWMTNPFSSLPGSQGAPQRISFLGQTPGPQECMEMMFREFGTGFEQSNAFIQLLTTLLVPPEGLNSLNDSVPFPEWLGSSIRTLGIEPYVDFVFDVFANRTKDISDPSQLRILRLSCLDFVMVCLVTFNEDLIVLGHESNISIDDAMAATNLATYVRLHPFSRVMEWLFNEKVITSLINTIHQDPISLGSASPDSPLVVSILRAIQVMIKALELQETYLHLVRPEVLRYQGEAGVRRKPVANAAYSAFEDGILSHLSLVVDLGKYCNLGHAELTLACLKLLEKISTSSRILSAWSPDSGRLGHRNKAIVQLERNGEGETISASLSASIMATLDPALAASGENYRVKLAILDFLYACLRATPDQPTIAHQLLGFHCELSKLGIEPKGPFDMQKSLFHSLLNVLITLTVSEEEQGMRGYLVTLKYRVLRILQLLWKSPLSASLVMDELRATNFLFHMLLREVQIQPQLPWDGQLVTGCEFLLSDASLAYIDYLASRAAIFEYIGKELCSVSQNRIPSIKRQIFDALNGQIFVDEEAPLTIPSIFDFFDFINTDYKWEEIPSPHFTYLKDLDLGPCILEHKYAGVHYDIRKAQEILALKRKEYEHSQLATPEFLETVELEEKVLIEWLTVRNRANLLLTARLNLLQAWANLLLVMIESNDFKSTPKMAFLLQALQAILPTLEAFSSLKSDEAFELARVAKVLLWKLDFSQDSDAGLDREQFTVGNLIGDKLFQLFQLCLSAISQCSGTPELRSLYYSICYRYLTAVVDNDATVAATPASSTIGPTRSVTNARARTLKAITLYGDRLLNVICDDAYGSDTTCQTAAMILLNALVHTSRASSAAGVSPADVDCPIIDALNRLNFIGVLVDSLKEILNEWLAPSSTFDPSLSTNASPSLPIPASPSQQYTSAKLALLLQLCQTRQGAKYVLQANLFRALEQSGVFAADPELVEVDSESGVPRVVALERHYALLVALARVVGAAVTARGAHNIVQGRKFLTQHRGLVVHVLKKNAGIGGGVVGNSLASSINGGSTATMTRRDEILAQQALEERIEELAEAFMLLITATGFLEYESEQVPSEQPRAHTTFFH nup53_chatd Nucleoporin NUP53 Nuclear pore protein NUP53 CTHT_0012410 NUP53 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MPPLILHNVPDDELYVGDDGIQRPFAMVFPQQDGSLRSRKANLETGAFGKSTRRTRSKAATPAKREDPTIAAADKIFSNWLASQNQSAPQTSVPAPAQRKPNLIPSSSSQNLAQGHDESSAPSQTRFFRKQEPTEVILRGYRNAQHQYAAINHYEQIAGRICEDYPREPPVESRRYKSELRDPAFTHRRALTPEERAKVNRAMSGEHWVKVTFESAEAADKAVYSSPQLIQGHLVYAEYYKGVPPAQDEAIPDPSVAAFGAALSRTQTLRQRNRGSFSLSGTQEAGGPDASPTSSLTADTGTLASGVEISTSTSNTLNGGAAAGGAEKSQDDEFCRVIPTVRKAKLLPMEEALLPAPTFTQRIANHIPFLRWFNGAMIGSEVPRTETGEFDWVRASLFWKLMWWLDFLLGLFGGDIRDAEKDDKED nup49_chatd Nucleoporin NUP49 NUP49 Nuclear pore protein NUP49 CTHT_0031980 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSLFGTNTTSQTPAGGGLFGTTTSQSAQTGSLFGTATSQPQQTGGLFGSTATQTPSSQLQSTGLFGSTTATSQPQQTGGLFGSTTTTTSQPQQTGGLFGATATSQPQSTGGLFGNTTTTSQPAQTVGLFGTTTQPQPAQSGGLFGSATQQKPATGGLFGSTTTNTGAGLFGNTSNTIGGGGLFGQTAKPATGGLFGQSTTQPQQQQNATPGLTMGQSTNTQQQVVPGVRIDLSNIKSTTRFNDLTEALQQEIAKIDEEIQKCIRDKEAVDAFLPAHGEQLAAIPTDVNFVTRKSEGAHNALSSDILAIDQLRELVKQDADNARLSFKAIDNLKLPMQYHQAGLWSKQMGGAGTAGASGASADADGQSNADLISYFSKTADEMEEMMKKFEKTITEIEAHLTGVEAHAMAMQNVAAQSRNAAQGGVDERVYELAAVLREFEESILKVAGVVGGVKEGVTELQLRDFMGHGS nup57_chatd Nucleoporin NUP57 NUP57 Nuclear pore protein NUP57 CTHT_0010940 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MFSSLNTRPAGQSLFGANTGGGLFGQSLANQPQQQQQPLQQQQQQAAPALGQSQINQNQQLGGSLWQPGSLTAYQKPIPEQIKLIVDKWNPNHPNCAFKTYLYNKVDEHTVPLYGPGPNEDPKEWEEALQRKPAPNFIPVLCSGFPSIVARLMLQRRVITEFNNKLHQINASLDAILSRHDLDHTVRAFNARRRHAELSRRCLHLAARVQVLRNRGYALSGDEDELKQKLQQIDKTLNDPAQGSRLEELWSRLIVLRGYAEDLKDQINQAGITESDGLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQHNPAPAPAR nsp1_chatd Nucleoporin NSP1 NSP1 Nuclear pore protein NSP1 Nucleoskeletal-like protein CTHT_0054390 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSFTFGQPSTSGASGQSNTSTAPASGGLFGSTTGSSTPAFSFGNTSGTQSGSLFGGATTGQKTSLFGNTSSTTPAGTPATSLFGQSTSSSSGPSLFGNASKPSGNLFGNTSTSAAGSSTPAGTPSLFGSKTATTSAGASSTTPAATAGSGSLFGSTTATTQGSSTPTSTGLFGGSSTASKSLFGSTTTPATGTSGSQTTPAKPLFGSFGSTTPAGAPPTDATKTAGLFGNLSKPATTGTSTPTLFGSTSATTQGQSSTPLFGAKPAETSTTTAASGAATPATSAPASTTPTLFGGATLTSSAPAASTSTSTATASTPAATKPLFGATATTSAPGSSTTTATPGLFSTTPATTAAAGSSTATSTLFGTKPATTTAAAASSTPAATSTPSLFGSKPASTTAPASGTPTTTTAPASTSAPATTTAAPTSGASATASTTTAGQDAKTTTAGLGASTVGPQSQLPRLKNKTMDEIITRWATDLAKYQKEFKEQAAKVMEWDRLLVENGEKIQKLYTSTYEAERASNEIERQLSNVESQQEELTAWLDRYERELDELYAKQMGSAAGEQAAGPDQERERTYKLAEKLTDQLDEMGKDLAKMIKEINDMSNTLSKGSKPDDPLTQIVRVLNGHLAQLQWIDTNAAALQAKVAAAQKAAGSMGANVPGTETDAAESFYRSYRGGLK nu159_chatd Nucleoporin NUP159 NUP159 Nuclear pore protein NUP159 CTHT_0054650 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAFSFGNAGGGGGGVTQGKDLEVIQTEGLGFLALAGDAKVQLTSKWSPPPAPTASLLSIASRKGLVAAAGPDAVHVATTESVRKAFLAEKNGDSEVRPFNPEAKLPLPLRISQLAFTADEQYLVLSAETGGGLRAYDVNSLTQGNTQSAFELATNGETLRQLAPNPMPESAAFCAIVTTNGNLYMANLAERTLVSGPNGPTLRSQVSCAAWSTKGKQLVAGMADGSIYQMTPDGTEKAHIPKPPNLGDYHVSSVVWLENNVFLTIHNPTNSTNPDDKTVYHVITRQQSSGSPPNFTFQKLNDPVEPFVADKTPHHTVLRLKDFPPNLQDLLLVSSTAVETIGLLTRSKTPLATDKPADAITNVFTTTELADDSRRAQLPMSEDMMETYPIGVALDLSSKEKVYKPIPTDEEIEYSPGPLPGLWVLNNEGVLASWWVVYNESIRAGTTYSGIGGSSEVIPASPAPALASSTAPVPAFASPVSKPTFGSPSPATPAFGGPSALGTKASPWATAGGAASSTPTFGQPSFGKPAAPAFGQASFPGLGQKVSPWATGSTTSAAPAFGQSGFASAGTAPGKVFGSSFTAPSSGGFASFATKSGFASLSAPSGGSSIFSSKPGAPLTSAAPEVSMDTDTAFPPPSTKTDKPAFGSSPFVLGSTFKADPTAAHDIEKPKEGESKSLFDTGFGLSLEDAAKQPASAAESKDEEMRSTTPPLPPPTETKPKSIFESTTPTTTPAPQKFEFKTTTPSGFSTLLGSTKPVASSMPNIFATPKPTSAEKPKSIFDTLKPKEESKENLLKASEPPLPPDTTSKAVFQPGSSSSESAESSPGAAAKAAFKVGNDETPKPQKELAPKPEAVPLPPDFVKAKPKTEAKETKAEEPAVSPNLPVKPLAKKAEPIPAVPESASEEEQGQAEEEEAESGEEEEEEEEEGEGEEEEEEEEEEEEEEEEGEEGEEQSEAGSEGSGVDVAKDLSPTAKFGSMTPGYTPHTSLGGMAESTFSTISRSEVAEQSRPLFGEITKNAPPLFPAAGPLPVSPRSPSPVRGVVRSSILRPTETPRPVDTTPVPSRKGLLQKTASFGMSTGQKPAVDPNVKAQRKLAEKLKAEEQVLVDPEDEGIQQILQSKVEPTLRMNEFLAVDTKLAPMKPGRDDVPNACETLWRDINRMIDRLGLNSRSLQSFILGHTSHGKPGGRQKDDLEKPDDWVLIEAYDLGDMIDNKLARELEAGRIKDVEGTMAAIHNLGRDLAKLRAKEEDLRKLFNAQVDPDQIALTKALPLSAEQLAQQNELRRSYASFSKLLTEAEEALTVLKAKLASANAARGRRGAGAAQVPTVDAIIRTINKMTSMAEKRSGDIDVLESQMRKLRIGSLGPAGTPNGNGVGAGTVVPATPGGGGRSRESSPFVTPQSSRRAMFMSPGSVGTATPRGLLAATGTPSPTKKKLSMYTAEEKRELRAREAKRKATLRMLRESLARVGPNVVRLRDDD nup82_chatd Nucleoporin NUP82 NUP82 Nuclear pore protein NUP82 CTHT_0022610 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MPKIKSFAPAWLNEPAPGHKLFAPAADDGTATVPLAYGKKIKPGPRRTIARRGTEIFVACGKQIRWGDLAQLKESWESRPSRSSVGPTSTKKDSSDFDDGAATAGYRIIKTPVADDIRQLVMSPNQDFLAVLTSHTVHICILPDSSHLHIQDTTPFKPKFWTLGPTTHVTSRSAVVSAVWHPLGVNGHALVTVTEDAIVRVWELSTADRWTFDAPTLAIDLKKLADATYLDQDFGVSTSATNKGFSPDAFDMEVAAACFPTRDSGGWAPMTLWLAMTSGDVYALCPLLPQRWTPPPTLIPSLSASIVAKVAAAEDNPESTPEERLVAQQQLEWMSEIDNQEPKLVEEATGEATIEVYTRPSRPGLVPKLQGPFDFDLNPEDEQDDEVELKDIYVIGEKPRVADLMRGEEEELEMMKEDQHNGLSLNIICLLSTSGQVKICLDIDGVEAQWLPPRSKNKRLFAPPPEPPSLLTFQTFDTLKPAEVTPDGWPMFSEDATSPYSFYVTHPAGITYISLTPWVFRLESELQSDSEAGTEFRIDLLAKGQGSERDRIFTQTRTQSPLAAATSIDDPDLGYFILSATQTDPIALFFETPERPVVPKETSVVIPEHVEERPPSPYWEPRPLFHPAEALDKPSAVPAWIDNLRTGRRRPLLTQELRLSMATLEVFHDGHKVVSTEVSDINDAVAELFRKCEALQGELRDQIKKVNEVKNRIHTITGDDLSDDPPVSEDQLIKQRIRVARERQEELANRMERLRKKFGRTTTRELSDKEKAWIEEVQNMATSILGPEAGQGALATTPNLAKQPWKRLEEIKTLRNALMAEAEQLQKVGDDTEESTPASQMPSLKIPSEIRKAKMAQVMSLLERESALVDAVKARIERLSIG nu145_chatd Nucleoporin NUP145 NUP145 Nuclear pore protein NUP145 CTHT_0042590 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSFGFGSGGFGQNNNSSTFGGFGSTPTTNTGFGSTGTTAFGSTSNTTGGGLFGGGGGGFGSGNTFGSGFGSKPAFGTPATTSSTSLFGSTTTTAGGTGFGSGGFGSTNTSSPFGGGGTSLFGNKTTTGFGSGTSTFGSNTGGGLFGGGSTTTGFGATNNPGIGTNVGDPPGTAVVPFSPTVEKEVNNPSQSNSYQNILFMDAYKKWSAEELRLADYNQGRKTAAPGGTGAFGSSGFGGFGTTSNTGGFGSNTGGGLFGNTQQNTGGFGTTNTTGSAFGSGGGLFGNKPATGGLFGTSSSQPAQSGGLFGSGTASTFGSSNTGTTSTFGSNNNTGGGLFGSNNTSSKPAFSFGTSNTSTPGFGTATTGSGFGTGTTTNTGGGLFGNTAQNTNTGGGLFGNQQQSGSAFGSGTGFGQQNQSTGTSLFGNTQQKPGGLFGSTTTNTSGGLFGSTNTGTSTFGQTPATQNTGGGLFGSKPAGTGGLFGSTATNQPASTGGLFGNLNTNAQTQQPATGGLFGNLGQNNQAKPSLFGTSTTTGGGLFGNTNAQQQTGSLFGTSTAQQQPQTGLGASLFGSSQQQQQQPQTFSTSITDISAYGATTLFSGLPDDKIQNPGPLATPLSGKAKVKSRSILPMYKLSPANASRLVTTPQKRAYGFSFSAYGSPTSPSSSASSTPGAFGQSILSSSINRGLNKSISASNLRRSLNVEDSILQPGAFSANSSMRLLGGPGSHKKLVINKDMRTDLFSPPNKDKQPQEDGTAARKTVTKRVSFDTSNVETPEKTIESSIPATDDSGYLKPDARSTANGTNGANGAKSSPVAAASPPEMEQVKGKELAVVHEEESPAPAQTDKPRGSQIEPGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNINLDDLFGTIVILEPRSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGRRLERHIERLKSIPDTTFESYDPETGVWAFSVEHFTTYGLGDDDDYDDDDYETEPESAVKSTPRPVTSPSISKSSTSPIDPDDTFEFRRSRRALPGAFDDAALSDTDEVANHAQRQGTLSPEPQDADTPLPSREWPEDESMADGLDEYQLEAYEEASQQGSVDEQEDFLPSRFAADNDAPQVPAGIMRARMRAVKKLNAPTKIEVAGGDDWTQILQASVKAPRTMDRATLRALNESGAVWEMKDRGSPPPQATATVSDGMGFATSIDLMKSLFEQAKAPTQPALTTSGKGFVKWPYEQRSKTDTEENLAVPRTNWGPNELLISTQHNEPNLLPVDAADDSATSPSTLARLQQYINLVSSKKQLQRVAGPEFRELAQGDSVWELAALLFDDNGEGVSQFWQQLVSEATDRALSFTAGLEEKAIICLAGNRVDEACRHLLAAGNFRLATLVSTIGKVDNKDIRAQLKDWRESNVLAEFSEPIRAIYELLAGNASVCAGVKNVPIENRVNSFTISQRFGLDWMRSFGLRLWYTSGVIPDVAAAVRSFQEDIEQDREPEPDSALWTLLKAFASREYDWSDTRLGWLLTKAIYTTGKVSFGEDALQKLDKASVTFASALTAASHWVPATFVLLQLSDPASREAAVRDHLGRHAHRIGSPRNLMSPFFTLQKFGVPEAWIWEAKALDYRSRQDSQQEFLALIWAQNYAEANRTFVTRVGPDLVIERNLPRLFAFAQLLFKVKKHLPNWERSAAVYLLYPMAVMQNQGSGKLDRFDNQLIDGLVALHSQTHGDIRQEAAIADMAEELIKCKGAAAASDPRLLQLLPQDVRGKYLRAQVLEAF nu116_yeast Nucleoporin NUP116/NSP116 NUP116 NSP116 YMR047C YM9532.12C Nuclear pore protein NUP116/NSP116 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFGVSRGAFPSATTQPFGSTGSTFGGQQQQQQPVANTSAFGLSQQTNTTQAPAFGNFGNQTSNSPFGMSGSTTANGTPFGQSQLTNNNASGSIFGGMGNNTALSAGSASVVPNSTAGTSIKPFTTFEEKDPTTGVINVFQSITCMPEYRNFSFEELRFQDYQAGRKFGTSQNGTGTTFNNPQGTTNTGFGIMGNNNSTTSATTGGLFGQKPATGMFGTGTGSGGGFGSGATNSTGLFGSSTNLSGNSAFGANKPATSGGLFGNTTNNPTNGTNNTGLFGQQNSNTNGGLFGQQQNSFGANNVSNGGAFGQVNRGAFPQQQTQQGSGGIFGQSNANANGGAFGQQQGTGALFGAKPASGGLFGQSAGSKAFGMNTNPTGTTGGLFGQTNQQQSGGGLFGQQQNSNAGGLFGQNNQSQNQSGLFGQQNSSNAFGQPQQQGGLFGSKPAGGLFGQQQGASTFASGNAQNNSIFGQNNQQQQSTGGLFGQQNNQSQSQPGGLFGQTNQNNNQPFGQNGLQQPQQNNSLFGAKPTGFGNTSLFSNSTTNQSNGISGNNLQQQSGGLFQNKQQPASGGLFGSKPSNTVGGGLFGNNQVANQNNPASTSGGLFGSKPATGSLFGGTNSTAPNASSGGIFGSNNASNTAATTNSTGLFGNKPVGAGASTSAGGLFGNNNNSSLNNSNGSTGLFGSNNTSQSTNAGGLFQNNTSTNTSGGGLFSQPSQSMAQSQNALQQQQQQQRLQIQNNNPYGTNELFSKATVTNTVSYPIQPSATKIKADERKKASLTNAYKMIPKTLFTAKLKTNNSVMDKAQIKVDPKLSISIDKKNNQIAISNQQEENLDESILKASELLFNPDKRSFKNLINNRKMLIASEEKNNGSQNNDMNFKSKSEEQETILGKPKMDEKETANGGERMVLSSKNDGEDSATKHHSRNMDEENKENVADLQKQEYSEDDKKAVFADVAEKDASFINENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAEQT FBAB0B9AEA958213 nu170_yeast Nucleoporin NUP170 NUP170 NLE3 YBL079W YBL0725 Nuclear pore protein NUP170 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQPTHILNSYPITGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIQQELLHQQQEQAKRSFPFFSNLMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKENSSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLETAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFEDLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRYSVSTVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE 3BEA65DAA2A5F99A scnup145-scnup192-1 3283744 N/A 3283775 unspecified role unspecified role bait bait Region 239-335 Region 239-335 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false nup53-nic96-4 3283745 N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey Region 245-1112 Region 245-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait Region 1-389 Region 1-389 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false nic96-nsp1-1 3283746 N/A 3283778 unspecified role unspecified role bait bait Region 132-182 Region 132-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3283781 unspecified role unspecified role prey prey Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nup53-nic96-5 3283747 N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role prey prey Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false scnup116-scnup192-1 3283748 N/A 3283776 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283787 unspecified role unspecified role bait bait Region 756-816 Region 756-816 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false nup49-nsp1-1 3283749 N/A 3283781 unspecified role unspecified role bait bait Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nsp1-nup159-4 3283750 N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role unspecified role unspecified role Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nup53-nic96-6 3283751 N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey Region 245-1112 Region 245-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait Region 1-389 Region 1-389 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false nsp1-nup49-1 3283752 N/A 3283781 unspecified role unspecified role unspecified role unspecified role Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role unspecified role unspecified role Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false nup53-nic96-7 3283753 N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false nup49-nic96-1 3283754 N/A 3283778 unspecified role unspecified role prey prey Region 135-1112 Region 135-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283781 unspecified role unspecified role bait bait Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nup53-nic96-8 3283755 N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role prey prey Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey Region 245-1112 Region 245-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait Region 1-389 Region 1-389 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false scnup145-scnup170-1 3283756 N/A 3283788 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283775 unspecified role unspecified role bait bait Region 353-405 Region 353-405 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false nic96-nsp1-2 3283757 N/A 3283779 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role unspecified role unspecified role Region 135-1112 Region 135-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283781 unspecified role unspecified role unspecified role unspecified role Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role unspecified role unspecified role Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false nup53-nic96-9 3283758 N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3283781 unspecified role unspecified role prey prey Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false nup145-nup170-1 3283759 N/A 3283786 unspecified role unspecified role bait bait Region 721-773 Region 721-773 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false nup145-nup192-2 3283760 N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role bait bait Region 606-684 Region 606-684 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false nsp1-nup49-2 3283761 N/A 3283781 unspecified role unspecified role prey prey Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role bait bait Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false nup53-nic96-10 3283762 N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false nup49-nic96-2 3283763 N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey Region 135-1112 Region 135-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283781 unspecified role unspecified role bait bait Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nup145-nup82-2 3283764 N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role bait bait Region 606-887 Region 606-887 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 887-993 Region 887-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nsp1-nup159-5 3283765 N/A 3283783 unspecified role unspecified role bait bait Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role prey prey Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nsp1-nup49-3 3283766 N/A 3283781 unspecified role unspecified role unspecified role unspecified role Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role unspecified role unspecified role Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false nup159-nsp1-4 3283767 N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role bait bait Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false nic96-nsp1-3 3283768 N/A 3283778 unspecified role unspecified role bait bait Region 132-226 Region 132-226 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283781 unspecified role unspecified role prey prey Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role prey prey Region 158-313 Region 158-313 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nup53-nic96-11 3283769 N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3283781 unspecified role unspecified role prey prey Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role prey prey Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role prey prey Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283780 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false nup145-nup82-3 3283770 N/A 3283785 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3283786 unspecified role unspecified role bait bait Region 887-993 Region 887-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false nup192-nup145-1 3283771 N/A 3283779 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nic96-nsp1-4 3283772 N/A 3283779 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283778 unspecified role unspecified role unspecified role unspecified role Region 135-1112 Region 135-1112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283781 unspecified role unspecified role unspecified role unspecified role Region 226-470 Region 226-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283782 unspecified role unspecified role unspecified role unspecified role Region 74-326 Region 74-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false nsp1-nup159-6 3283773 N/A 3283783 unspecified role unspecified role unspecified role unspecified role Region 448-678 Region 448-678 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283784 unspecified role unspecified role unspecified role unspecified role Region 1102-1481 Region 1102-1481 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283785 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false nup192-nup145-2 3283774 N/A 3283777 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283779 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3283786 unspecified role unspecified role prey prey Region 606-993 Region 606-993 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false