DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ li-2015-41 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. DIP original experiment: DIP-267272X Structure (London, England : 1993) 2015 IMEx Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome. Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. Only protein-protein interactions imex curation li-2015-42 mycsm Mycobacterium smegmatis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. DIP original experiment: DIP-267268X Structure (London, England : 1993) 2015 IMEx Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome. Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. Only protein-protein interactions imex curation li-2015-43 mycsm Mycobacterium smegmatis x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. DIP original experiment: DIP-267269X Structure (London, England : 1993) 2015 IMEx Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome. Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. Only protein-protein interactions imex curation li-2015-44 mycsm Mycobacterium smegmatis bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. DIP original experiment: DIP-267270X Structure (London, England : 1993) 2015 IMEx Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome. Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. Only protein-protein interactions imex curation li-2015-45 mycsm Mycobacterium smegmatis crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. DIP original experiment: DIP-267271X Structure (London, England : 1993) 2015 IMEx Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome. Li X., Sun Q., Jiang C., Yang K., Hung LW., Zhang J., Sacchettini JC. Only protein-protein interactions imex curation rl14_myctu 50S ribosomal protein L14 rplN MTCY210.33 Rv0714 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREKRFMKIISLAPEVL o86327_myctu Ribosomal silencing factor RsfS rsfS Rv2420c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTANREAIDMARVAAGAAAAKLADDVVVIDVSGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQAGYRPARREGAREGRWTLLDYRDIVVHIQHQDDRNFYALDRLWGDCPVVPVDLSANSAGAQ rpln-rsfs-1 3282831 N/A 3282836 unspecified role unspecified role unspecified role unspecified role myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) N/A 3282837 unspecified role unspecified role unspecified role unspecified role mycsm Mycobacterium smegmatis direct interaction direct interaction false false false rsfs-1 3282832 N/A 3282837 unspecified role unspecified role unspecified role unspecified role mycsm Mycobacterium smegmatis direct interaction direct interaction false false false rsfs-2 3282833 N/A 3282837 unspecified role unspecified role unspecified role unspecified role mycsm Mycobacterium smegmatis direct interaction direct interaction false false false rsfs-3 3282834 N/A 3282837 unspecified role unspecified role unspecified role unspecified role mycsm Mycobacterium smegmatis direct interaction direct interaction false false false rsfs-4 3282835 N/A 3282837 unspecified role unspecified role unspecified role unspecified role mycsm Mycobacterium smegmatis direct interaction direct interaction false false false