UniProt UniProt http://www.uniprot.org wu-2015-3 human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu M., Puddifoot CA., Taylor P., Joiner WJ. Chrna4/alpha-4 constructs according Ref. 43 (PMID 21187334) wjoiner@ucsd.edu The Journal of biological chemistry 2015 imex curation Only protein-protein interactions lypd1_mouse Ly6/PLAUR domain-containing protein 1 Lypd1 Lypdc1 MNCb-0671 Ly-6/neurotoxin-like protein 2 protein protein mouse Mus musculus Mouse MWVLGIAATFCGLFWLPGLALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASAIRPGLLTTLLFFHLALCLAHC acha4_mouse Neuronal acetylcholine receptor subunit alpha-4 Chrna4 Acra4 protein protein mouse Mus musculus Mouse MEIGGSGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPESEPGILGDICNQGLSPAPTFCNRMDTAVETQPTCRSPSHKVPDLKTSEVEKASPCPSPGSCHPPNSSGAPVLIKARSLSVQHVPSSQEAAEGSIRCRSRSIQYCVSQDGAASLTESKPTGSPASLKTRPSQLPVSDQTSPCKCTCKEPSPVSPITVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI achb2_mouse Neuronal acetylcholine receptor subunit beta-2 Chrnb2 protein protein mouse Mus musculus Mouse MARCSNSMALLFSFGLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGTLFFREGPAADPCTCFVNPASMQGLAGAFQAEPAAAGLGRSMGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTATTFLHSDHSAPSSK ly6h_mouse Lymphocyte antigen 6H Ly6h protein protein mouse Mus musculus Mouse MLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQPTDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGASVAGRSPWALAGGLLLSLGPALLWAGP ly6e_mouse Lymphocyte antigen 6E Ly6e Ly67 Sca-2 Tsa-1 Stem cell antigen 2 Thymic shared antigen 1 protein protein mouse Mus musculus Mouse MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP ly66e_mouse Lymphocyte antigen 6G6e Ly6g6e Lymphocyte antigen 6 complex locus protein G6e protein protein mouse Mus musculus Mouse MGPSSAFLGVLFLSGTLGLTTSPARGRLRCYTCSFAKPCDPVPRECREDEVCGVSVGTSGRTLVRWPFSRWLLSFLPMAAAATSAFLFCPTEQKEEEVIERKGCLPRAQCPLLGHATYWSRSYSLRHQCCEQDLCNAAASQPPPNLPLMTLLPLAAMIGWGVHDFL chrna4-lypd1-1 2969049 N/A 2969050 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range false N/A 2969051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain false N/A 2969052 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 2A and C chrna4-ly6h-1 2969049 N/A 2969053 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range false N/A 2969051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain false N/A 2969052 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 2A chrna4-ly6e-1 2969049 N/A 2969054 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range false N/A 2969051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain false N/A 2969052 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 2A chrna4-chrnb2-1 2969049 N/A 2969055 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2969051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2969052 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 2B chrna4-lypd1-2 2969049 N/A 2969050 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range false N/A 2969051 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2C