DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lin-2015-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin DY., Huang S., Chen J. DIP original experiment: DIP-265980X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Lin DY., Huang S., Chen J. Only protein-protein interactions imex curation lin-2015-8 in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265981X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Lin DY., Huang S., Chen J. Only protein-protein interactions imex curation lin-2015-9 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265983X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Lin DY., Huang S., Chen J. Only protein-protein interactions imex curation lin-2015-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265984X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Lin DY., Huang S., Chen J. Only protein-protein interactions imex curation lin-2015-11 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Lin DY., Huang S., Chen J. DIP original experiment: DIP-265982X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Lin DY., Huang S., Chen J. Only protein-protein interactions imex curation a3dcu1_acet2 Cthe_0534 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MLRRLFKKKYVCVRQYDLTDCGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRLAHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKGDYTQNMMVKFAGFLKPLKKTVLCIFLASLLYTALGIAGSFYIKFLFDDLIKFEKLNDLHIISAGFAVIFLLQIFLNYYRSILVTKLGMSIDKSIMMEYYSHVLKLPMNFFNSRKVGEIISRFMDASKIRQAISGATLTIMIDTIMAVIGGILLYIQNSSLFFISFIIILLYGIIVTVFNKPIQNANRQIMEDNAKLTSALVESVKGIETIKSFGAEEQTEKSTRDKIETVMKSSFKEGMLYINLSSLTGIVAGLGGIVILWAGAYNVIKGNMSGGQLLAFNALLAYFLTPVKNLIDLQPLIQTAVVASNRLGEILELATEKELREDSDDFVISLKGDIEFRNVDFRYGLRKPVLKNINLTIPKGKTVAIVGESGSGKTTLAKLLMNFYSPEKGDILINGHSIKNISLELIRKKIAFVSQDVFIFSGTVKENLCLGNENVDMDEIIKAAKMANAHDFIEKLPLKYDTFLNESGANLSEGQKQRLAIARALLKKPDILILDEATSNLDSITENHIKDAIYGLEDDVTVIIIAHRLSTIVNCDKIYLLKDGEIVESGSHTELIALKGCYFKMWKQTENTLAS a3dcu2_acet2 Cthe_0535 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MSEAKKLNIGRELTDEELMEMTGGSTFSIQCQKDYTYKPSLPVVKYGVVIDEPEVVIKYGVGPIVGIKYGVEPIGPIQPMYGIKPVETLK a3dcu1_cloth-1 3281036 N/A 3281041 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false a3dcu1_cloth-a3dcu2_cloth-1 3281037 N/A 3281042 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3281041 enzyme enzyme unspecified role unspecified role Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false A3DCU1:p.Cys21Ala C21A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false A3DCU1:p.His99Ala H99A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli protein cleavage protein cleavage false false false a3dcu1_cloth-a3dcu2_cloth-2 3281038 N/A 3281042 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3281041 unspecified role unspecified role bait bait Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false a3dcu2_cloth-a3dcu1_cloth-1 3281039 N/A 3281042 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3281041 unspecified role unspecified role prey prey Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false a3dcu1_cloth-a3dcu2_cloth-3 3281040 N/A 3281042 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3281041 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false