DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ steffens-2015-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265851X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-2 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265855X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265860X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265859X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265863X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265852X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-7 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265861X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-8 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265856X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-9 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265868X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265864X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-11 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265853X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265866X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-13 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265857X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-14 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265862X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265865X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-16 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265869X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-17 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265854X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-18 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265867X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation steffens-2015-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffens A., Bräutigam A., Jakoby M., Hülskamp M. DIP original experiment: DIP-265858X PLoS biology 2015 IMEx The BEACH Domain Protein SPIRRIG Is Essential for Arabidopsis Salt Stress Tolerance and Functions as a Regulator of Transcript Stabilization and Localization. Steffens A., Bräutigam A., Jakoby M., Hülskamp M. Only protein-protein interactions imex curation dcp1_arath mRNA-decapping enzyme-like protein DCP1 homolog T27G7.7 At1g08370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSQNGKIIPNLDQNSTRLLNLTVLQRIDPYIEEILITAAHVTFYEFNIELSQWSRKDVEGSLFVVKRSTQPRFQFIVMNRRNTDNLVENLLGDFEYEVQGPYLLYRNASQEVNGIWFYNKRECEEVATLFNRILSAYSKVNQKPKASSSKSEFEELEAKPTMAVMDGPLEPSSTARDAPDDPAFVNFFSSTMNLGNTASGSASGPYQSSAIPHQPHQPHQPTIAPPVAAAAPPQIQSPPPLQSSSPLMTLFDNNPEVISSNSNIHTDLVTPSFFGPPRMMAQPHLIPGVSMPTAPPLNPNNASHQQRSYGTPVLQPFPPPTPPPSLAPAPTGPVISRDKVKEALLSLLQEDEFIDKITRTLQNALQQ mint bcha1_arath Protein SPIRRIG SPI BCHA1 BEACH domain-containing protein A1 BEACH-domain homolog A1 F10O3.12 At1g03060 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKWATLLKDIKEKVGLAQSSDSDPFPVDLTAPPSSSSSSSSPSFTYPSSSSLHHFNFSPSSRDNHELELDFKRLWEEFRSSSSEKEKEAALNLTVDIFCRLVKRHANVDQLVTMLVETHIFSFVIGRAFVTDIEKLKIGSKTRSLNVEKVLRFFSDVTKEGFSPGANLLTAVEVLVSGPIDKQSLLDSGIFCCLIHVLIALLAYDELSKSKITGDLEVVSAEKDAGYIVLQTRRLEVEGSVVHIMKALASNPSAAQSLIEDDSLESLFNMVANGSITVFSQYKEGLVPLHNIQLHRHAMQILGLLLVNDNGSTARYIRKHHLIKVLLMAVKEFDPSCGDSAYTMGIVDLLLECVELSYRPEAGGVRLREDIRNAHGYHFLVQFALVLSSLPKNPIFVSSNHDSGSDDPEVFHDGENTNSTENADFSSQNFAPSLSRLLDVLVTLAQTGPAEPSVGRASRSSQTKPTGHSRSRTSSVDSIYDETWEQGSGKVKDLEAVQMLQDIFLKAENKDLQAEVLNRMFKIFSSHVENYRLCQELRTVPLLVLNMAGFPSSLQDIILKILEYAVTVVNCVPEQELLSLCCLLQQPITSQLKHTILSFFVKLISFDQQYKKVLREVGVLEVLQDDLKQHKLLIGPDQYSGVSSHSDRKPSSGSFRKNLDTKDAIISSPKLMESGSGKLPVFEVDNTITVGWDCLISLLKKAEANQSSFRAANGVAIILPFLISDAHRSGVLRILSCLITEDTKQVHHDELGAVVDLLKSGMVTGISGHQYKLHDDAKCDTMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGKREHMDESDLTVYIKLFKYLFRLMTAAVCENAVNRMKLHAVITSQTFFELLAESGLLCVELERQVIQLLLELALEVVVPPFLTSESTALATIPENENTTFVVTTPSGQFNPDKERIYNAGAVRVLIRSLLLFSPKMQLEFLRLLESLARASPFNQENLTSIGCVELLLEIIYPFLAGSSPFLSYALKIVEILGAYRLSPSELRMLFRYVLQMRIMNSGHAIVGMMEKLILMEDTALEHLSLAPFVELDMSKTGHASVQVSLGERSWPPAAGYSFVCWFQFRNFLTTQGKESEASKAGGSSKTRMTSAQQHEQNIFRMFSVGAVSNESPFYAELYFQEDGILTLATSNSHSLSFSGLEIEEGRWHHLAVVHSKPNALAGLFQASVAYVYLDGKLRHTGKLGYSPSPVGKSLQVTVGTPATCARVSDLTWKTRSCYLFEEVLTSGCIGFMYILGRGYKGLFQDADLLRFVPNQACGGGSMAILDSLDTDMTSSSNGQKFDGSNRQGDSKADGSGIVWDLERLGNLAFQLPGKKLIFAFDGTCSEFIRASGNFSLLNLVDPLSAAASPIGGIPRFGRLVGNVSICRQSVIGDTIRPVGGMTVVLALVEAAESRNMLHMALSLLACALHQNPQNVKDMQTIRGYHLLALFLRPKMTLFDMQSLEIFFQIAACEALFSEPKKLESVQSNITMPPTETIFENSYEDLSLSRFRYDSSSVGSHGDMDDFSVPKDSFSHLSELETDIPVETSNCIVLSNADMVEHVLLDWTLWVTSPVSIQIALLGFLENLVSMHWYRNHNLTILRRINLVEHLLVTLQRGDVEVPVLEKLVVLLGCILEDGFLTSELENVVRFVIMTFNPPEVKSRSSLLRESMGKHVIVRNMLLEMLIDLQVTIKAEDLLELWHKIVSSKLITYFLDEAVHPTSMRWIMTLLGVCLASSPNFSLKFRTSGGYQGLLRVLQNFYDSPDIYYILFCLIFGKPVYPRLPEVRMLDFHALVPNDGSYVELKFIELLDSVVAMAKSTYDRLIMQSMLAHQSGNLSQVSASLVAELIEGAEMTGELQGEALMHKTYAARLMGGEASAPAAATSVLRFMVDLAKMCPQFSTACRRAEFVENCADLYFSCVRAAYAVKMAKQLSVKAEEKHINDADDSGSQGSLPHDQDQSTKTSISVGSFPQGQVSLGSEDMSLPANYVVNDKMENILPPPTQDTSKSLQGVEDVKKQDDHHVGPSASSERDFQDFTGNPVQVQATDSQSSASFPMIESPLLSEKSSLKVSFTPSPSPVVALASWLGSNYNESKSSTLGSPSLESYVSVNEVDASSERKSGSQGSSAANAFFTVSPKLLLETDETGYGGGPCSAGASAVLDFMAEALADLVTEQIKAVPVLESILEMVPFYVDPESVLVFQGLCLSRVMNYLERRLLRDDEEDEKKLDKAKWSVNLDAFCWMIVDRVYMGAFSQPAGVLRALEFLLSMLQLANKDGRVEEVTPSGKGLLSLGRATRQLDAYVHSILKNTNRMVLYCFLPSFLITIGEEDLLSQLGLLVESKKRPSPNPATDESGIDISTVLQLLVANRRIIFCPSNLDTDLNCCLCVNLISLLLDQRKSVQNMSLDIVKYLLVHRRSALEDLLVTKPNQGQNFDVLHGGFDKLLTGNLPEFFKWLESSDKIINKVLEQCAAIMWVQYIAGSAKFPGVRIKGMEGRRKREMGRKSRDMSKLDLKHWDQLNERRYALEVLRDAMSTELRVVRQNKYGWILHAESEWQTHLQQLVHERGIFPMRKSKGTEDPEWQLCPIEGPYRMRKKLERCKLKIDSIQNVLDGKLELGEIELPKVKNEDGPVISDTDSEPPFLLSELYDESFLKESDDFKDVASARNGWNDDRASSTNEASLHSALDFGGKSSIASVPITDTTHVKSETGSPRHSSSAKMDETNGREEKSEKELNDDGEYLIRPYLEHLEKIRFRYNCERVVDLDKHDGIFLIGEFCLYVIENFYIDEDGCICEKECEDELSVIDQALGVKKDVSGSSDFHSKSSTSWTTTVKTGAVGGRAWAYGGGAWGKEKMCMTGNLPHPWRMWKLNNVHEILKRDYQLRPVAIEIFSMDGCNDLLVFHKKEREEVFKNLVAMNLPRNSMLDTTISGSAKQESNEGGRLFKLMAKSFSKRWQNGEISNFQYLMHLNTLAGRGYSDLTQYPVFPWVLADYDSESLDFSDPKTFRKLHKPMGCQTPEGEEEFRKRYESWDDPEVPKFHYGSHYSSAGIVLFYLIRLPPFSSENQKLQGGQFDHADRLFNSIKDTWLSAAGKGNTSDVKELIPEFFYMPEFLENRFSLDLGEKQSGEKVGDVFLPPWARGSVREFILKHREALESDYVSENLHHWIDLIFGYKQRGKAAEEAVNVFYHYTYEGNVDIDAVTDPAMKASILAQINHFGQTPKQLFPKAHVKRRTDRKIPLHPLKHSMHLVPHEIRKCSSSISQIITFHDKVLVAGANCFLKPRGYTKYITWGFPDRSLRFMSYDQDKLLSTHENLHESNQIQCAGVSHDGRIVVTGAEDGLVCVWRVSKDGPRGSRRLRLEKALCAHTAKVTCLRVSQPYMMIASGSDDCTVIIWDLSSLSFVRQLPDFPVPISAIYINDLTGEIVTAAGTVLAVWSINGDCLAVANTSQLPSDSVLSVTGSTSSDWLETSWYVTGHQSGAVKVWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKFHKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRASMKQASLKQASLKQASLKQASSV dcp1b_human mRNA-decapping enzyme 1B DCP1B protein protein human Homo sapiens Human MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTM dcp1_yeast mRNA-decapping enzyme subunit 1 DCP1 YOL149W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA 8456B1C96C121C4D vps25_arath Vacuolar protein sorting-associated protein 25 VPS25 ESCRT-II complex subunit VPS25 F13C5 At4g19003 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKLADFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKSQKIFLIGVEEDFPLFSNSAIDRSLSHEARETFLSAIVGEGRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVEEIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKFSV vp202_arath Vacuolar protein sorting-associated protein 20 homolog 2 VPS20.2 CHMP6-2 Charged multivesicular body protein 6 homolog 2 ESCRT-III complex subunit VPS20 homolog 2 T2K12.4 T5E8.60 At5g09260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNLFVKKPKITEVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIREKRKDRALLALKKKRTQEELLKQVDQWLINVEQQLADIELTSKQKAVFESLKQGNNAIKAIQSEVNLDDVQKLMDDTAEAKAYQDELSAILGEKLSAEDEEEILAEFDNLESLLIVEDMPEVPTTELMPEEPEKMDLPDVPTKAPVASNETTSTKRKVLEEPLEA fan_human Protein FAN NSMAF FAN Factor associated with neutral sphingomyelinase activation protein protein human Homo sapiens Human MAFIRKKQQEQQLQLYSKERFSLLLLNLEEYYFEQHRANHILHKGSHHERKIRGSLKICSKSVIFEPDSISQPIIKIPLRDCIKIGKHGENGANRHFTKAKSGGISLIFSQVYFIKEHNVVAPYKIERGKMEYVFELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAEMVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIIHDYSSSELDLSNPGTFRDLSKPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDNADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELPPWASSPEDFLQKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVDLNSIQDPDEKVAMLTQILEFGQTPKQLFVTPHPRRITPKFKSLSQTSSYNASMADSPGEESFEDLTEESKTLAWNNITKLQLHEHYKIHKEAVTGITVSRNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYSIAFGRRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTISLNAASTLLVSGTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLISSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQIIFWKLQY dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL bh012_arath Transcription factor MYC1 At4g00480 BHLH12 EN58 MYC1 Transcription factor EN 58 bHLH transcription factor bHLH012 Basic helix-loop-helix protein 12 F6N23.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLTMADGVEAAAGRSKRQNSLLRKQLALAVRSVQWSYAIFWSSSLTQPGVLEWGEGCYNGDMKKRKKSYESHYKYGLQKSKELRKLYLSMLEGDSGTTVSTTHDNLNDDDDNCHSTSMMLSPDDLSDEEWYYLVSMSYVFSPSQCLPGRASATGETIWLCNAQYAENKLFSRSLLARSASIQTVVCFPYLGGVIELGVTELISEDHNLLRNIKSCLMEISAHQDNDDEKKMEIKISEEKHQLPLGISDEDLHYKRTISTVLNYSADRSGKNDKNIRHRQPNIVTSEPGSSFLRWKQCEQQVSGFVQKKKSQNVLRKILHDVPLMHTKRMFPSQNSGLNQDDPSDRRKENEKFSVLRTMVPTVNEVDKESILNNTIKYLQELEARVEELESCMGSVNFVERQRKTTENLNDSVLIEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVIEVRCSYRDYIVADIMETLSNLHMDAFSVRSHTLNKFLTLNLKAKFRGAAVASVGMIKRELRRVIGDLF spi-dcp1_arath-1 3280333 N/A 3280352 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280353 unspecified role unspecified role bait bait Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dcp1_arath-spi-1 3280334 N/A 3280352 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3280353 unspecified role unspecified role unspecified role unspecified role Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false spi-dcp1b-1 3280335 N/A 3280354 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280353 unspecified role unspecified role bait bait Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false spi-ydcp1-1 3280336 N/A 3280355 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280353 unspecified role unspecified role bait bait Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dcp1b-spi-1 3280337 N/A 3280354 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280353 unspecified role unspecified role prey prey Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false spi-dcp1_arath-2 3280338 N/A 3280352 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280353 unspecified role unspecified role bait bait Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ydcp1-spi-1 3280339 N/A 3280355 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280353 unspecified role unspecified role prey prey Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false vps20.2-vps25-1 3280340 N/A 3280356 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3280357 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false dcp1b-nsmaf-1 3280341 N/A 3280354 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280358 unspecified role unspecified role prey prey Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false nsmaf-dcp1a-1 3280342 N/A 3280358 unspecified role unspecified role bait bait Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280359 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dcp1_arath-spi-2 3280343 N/A 3280352 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280353 unspecified role unspecified role prey prey Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false nsmaf-dcp1_arath-1 3280344 N/A 3280352 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280358 unspecified role unspecified role bait bait Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false bhlh12-gl1-1 3280345 N/A 3280360 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3280361 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false dcp1a-spi-1 3280346 N/A 3280359 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280353 unspecified role unspecified role prey prey Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false nsmaf-dcp1b-1 3280347 N/A 3280358 unspecified role unspecified role bait bait Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280354 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dcp1_arath-nsmaf-1 3280348 N/A 3280352 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280358 unspecified role unspecified role prey prey Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false dcp1_arath-spi-3 3280349 N/A 3280352 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3280353 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress proximity proximity close-contact colocalization neighbourhood interaction false false false dcp1a-nsmaf-1 3280350 N/A 3280358 unspecified role unspecified role prey prey Region 1-579 Region 1-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3280359 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false spi-dcp1a-1 3280351 N/A 3280359 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3280353 unspecified role unspecified role bait bait Region 2560-3571 Region 2560-3571 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false