DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ karpowich-2015-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266074X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation karpowich-2015-2 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266076X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation karpowich-2015-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266075X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation karpowich-2015-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266078X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation karpowich-2015-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266077X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation karpowich-2015-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Karpowich NK., Song JM., Cocco N., Wang DN. DIP original experiment: DIP-266079X Nature structural & molecular biology 2015 IMEx ATP binding drives substrate capture in an ECF transporter by a release-and-catch mechanism. Karpowich NK., Song JM., Cocco N., Wang DN. Only protein-protein interactions imex curation ecfa2_thema Energy-coupling factor transporter ATP-binding protein EcfA2 ecfA2 ecfA ecfA' TM_0222 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MRIEVVNVSHIFHRGTPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFLEKYDPRFFTSKMLVMRRLVLKGEDPFSMSDDELLERVCNS ecfa1_thema Energy-coupling factor transporter ATP-binding protein EcfA1 ecfA1 cbiO ecfA' TM_1663 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKITLNSVSFRYNGDYVLKDVNAEFETGKIYVVVGKNGSGKTTLLKILAGLLEAEGEIFLDGSPADPFLLRKNVGYVFQNPSSQIIGATVEEDVAFSLEIMGLDESEMRKRIKKVLELVGLSGLEKEDPLNLSGGQKQRLAIASMLARDTRFLALDEPVSMLDPPSQREIFQVLESLKNEGKGIILVTHELEYLDDMDFILHISNGTIDFCGSWEEFVEREFDDVEIPFKWKLWKKCGKINLWEDRYENSGNQRRRDTV a0a0e1r7q2_lismn fmnP BN389_19700 protein protein listeria monocytogenes serotype 4b str. ll195 Listeria monocytogenes serotype 4b str. LL195 MLADLFVCLHEHVLASCDAYLSIRFLFIHSQTLPQLFSVEVFYLLGLHSSSDVTRFLVNIKGEMTMKNYSMKVFVSVAVLGTLAFILMMLQFPLLPSAPFLKLDFSDIPALIGGLLFGPLAVILVELIKNVLLYIVSGSPVGVPIGEISNFINGIVYVLPIYYLFHWFRSTKGMVFSTAIGTLVMTVVMSIFNYFILLPFYIKLGGLPADTDVAWLVTYAIIPFSLLKGVIVSAVFLLLYSRLKKWIAKNQTVKERRKFEKKQQEVSH a0a0b8qz10_lismn Energy-coupling factor transporter transmembrane protein EcfT D4C60_07835 D4D22_07430 D5M63_07505 E1V33_03430 GXB45_02150 GYZ61_01195 GZM52_03140 ecfT LmNIHS28_02168 D4271_06570 D4D89_07260 E5F58_10585 G3R95_002003 E0I39_07325 B1N06_10375 F6515_00765 FJU19_07165 protein protein lismn Listeria monocytogenes MMDKMILGRYIPGNSWLHRIDPRAKITAVMAFIAIVFLANNWLTYALMFAYVLYLVLTSKVPFLFFIKGLQPIFWLILITLLLQVFFTKGGTVLVDLGLLQITTLGLTNGAMMFCRFVLIIFMTTLLTLTTSPIELTDGLEKILAPFRLVHLPVHELALMLSISLRFIPTLMDETEKILKAQKARGVEFTSGKWSDRIKAIIPLLVPLFISAFKRAEDLAIAMEARGYRGGKGRTRFRLLRWRFADTFLLISLAVLSGLLFWLRS ecfa2_lismf Energy-coupling factor transporter ATP-binding protein EcfA2 ecfA2 cbiO2 LMOf2365_2573 protein protein lismf Listeria monocytogenes serotype 4b (strain F2365) MEIKLEQLGYCYQKNSPFEKRALLDVNVSFDSGSYSAIIGHTGSGKSTLLQHLNALLMPTEGKITVGDREIVAGVKQKKLRDLRKKVGIVFQFPEAQLFEETVEKDICFGPMNFGVSEEDAKLRAKKVIYEVGLTEEILSRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPHGREEIMEMFYNLHKEKGLTTVLVTHSMEDAARYAEKIVLMKAGTVLQIGTPREVFAKPDELVDLGLSVPDVVRFQGLFERKFDVKLTKTCLTIDELTTEMAPYLAKGGA ecfa1_lismf Energy-coupling factor transporter ATP-binding protein EcfA1 ecfA1 cbiO1 LMOf2365_2574 protein protein lismf Listeria monocytogenes serotype 4b (strain F2365) MAESFVRLEHVFYKYEDTEKYAVKDVSISAQKGEWVALVGHNGSGKSTIAKLLNGLLFPEDGLIKIGHFVLSEKNIWDIRRQVGMVFQNPDNQFVGATVQDDVAFGLENHGVPHDTMVERVESALNEVGMQSYALHEPARLSGGQKQRVAIAGVLALQPDVIILDEATSMLDPRGRAEVMETIRIMREQEDITVISITHDLDEVLFADRVIVMNNGEVHSEGTPQEIFEQADAMREIGLGVPFIIELQEKLVAGGFETGSTVLSEGALLDQLWKLNSNN a0a0b8r2u7_lismn B4Y49_01390 KW30_03945 thiT LmNIHS28_01831 B1N52_07435 D4920_01725 DCT16_07795 E5F58_09570 GJW51_06670 GYZ23_12280 GZI09_04265 B1N71_01160 B2H14_09845 B5K54_05330 BCZ19_05280 C6S26_03120 CW834_10820 CW845_06970 CW895_10830 D4164_01335 D4900_05065 D4947_01700 D5N24_03695 D7104_07575 DCK28_09450 E1W56_04955 EPC87_00780 EX365_07035 F3R75_05135 FNX40_09375 F6436_12925 FLQ97_07070 FLR11_05820 FNX31_11580 ABZ57_04425 ARV77_03365 FV747_03130 AMC55_03945 FA835_07720 FLR03_13500 A8L61_06350 ART25_07095 B1N70_06005 EXZ73_00100 F6515_04720 G3O21_000984 GHH22_03320 GYN46_00030 GYO86_07900 GYS19_07790 GYU05_00355 GYX95_03840 GYY14_05625 GYZ33_12895 GYZ61_10505 GZM52_06890 GZN68_08815 HP506_001051 HQN34_002230 KV70_03930 M643_01630 QD52_08055 R019_12175 UI29_08095 UP23_03730 protein protein lismn Listeria monocytogenes MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGVARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK ecfa1-ecfa2-5 3279786 N/A 3279792 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ecfa1-ecfa2-6 3279787 N/A 3279794 unspecified role unspecified role unspecified role unspecified role Region 66-268 Region 66-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279795 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279797 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ecfa1-ecfa2-7 3279788 N/A 3279794 unspecified role unspecified role unspecified role unspecified role Region 66-268 Region 66-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279795 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279797 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false ecfa1-ecfa2-8 3279789 N/A 3279792 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ecfa1-ecfa2-9 3279790 N/A 3279794 unspecified role unspecified role unspecified role unspecified role Region 66-268 Region 66-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279795 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279797 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false a0a0b8r2u7_lismn-ecfa1-1 3279791 N/A 3279798 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279794 unspecified role unspecified role unspecified role unspecified role Region 66-268 Region 66-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279795 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3279797 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false