DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lokareddy-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265791X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265787X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265798X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265792X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265788X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265795X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265789X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265793X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265796X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-10 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265799X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265790X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-12 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265794X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation lokareddy-2015-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. DIP original experiment: DIP-265797X Structure (London, England : 1993) 2015 IMEx Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2. Lokareddy RK., Hapsari RA., van Rheenen M., Pumroy RA., Bhardwaj A., Steen A., Veenhoff LM., Cingolani G. Only protein-protein interactions imex curation heh2_yeast Inner nuclear membrane protein HEH2 YDR458C D8035.2 HEH2 Helix-extension-helix domain-containing protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDHRNLDPKTLKVSQLRRVLVENDVAFPANARKPVLVKLFEEKVRQRLQSSPEASKVRTSIQKVVKSGAKNADRKKTLKSKKLESSSSESKTVKDENVETNKRKREQISTDNEAKMQIQEEKSPKKKRKKRSSKANKPPESPPQSKSDGKATSADLTSELETVEELHKKDSSDDKPRVKELPKPELPNLKVSNEFLAQLNKELASAATENYDHSIKSTDLSSIRIETEEPVGPSTGAETRNESEVMENINLEVQPEVKEAKEELTKISETFDNQDEEDTSRLSSKKNIRSPKGRTRHFIANKTKRGIDIMKPFIAHLFIWLWNGAIFLSIICPILFGLWYREQRIQVGYCGHEKPLKSLAISAFPQTERVDSVLQAYRPNCLECPEHGICSSFMNVECEPGYEPKSSILETYGIIPFPKYCAKDESKEKEVDELVWKVNEYLKKKNAQHECGEGENLFESGETETKLYDIFSHSRPSWESQREFNDHWKNVLEILKKKDDIIWLPLDFETNGKREKSKSNNTNYIYRSTSKKWVTLQCHLEGDIQEYITKYGGSLFITLGVLFLIKKIQSTLDNYVQGEQIIEKLVKEAIDKLKDVKKNKGEEPFLTTVQLRATLLSDIPNIKEQNNLWAQTKEKIMKEQSENIELYLLEENGEIMTCWEWKE 1E11821F2542723E ima1_yeast Importin subunit alpha SRP1 KAP60 YNL189W N1606 Karyopherin subunit alpha Karyopherin-60 Serine-rich RNA polymerase I suppressor protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFNFN 8D3A0CB76F2E7C00 src1_yeast Inner nuclear membrane protein SRC1 YML033W YML034W SRC1 HEH1 Helix-extension-helix domain-containing protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSDLEYLEDGFDPNSMKVATLRRILVENNVDFPSNARKNALVGLFDEKVKPQIPQLRKMYLNVRPSDEGIVKMDRPSSSPSIASPRRSRRARREKSASPMAKQFKKNRILDDVSNDDDDDDDDDDDNDKKDDPLIVPSGTDTDEVDDEEDDVITSSSNKSDTNDFQQNSDTRKKRKDPDSDDWSESNSKENKIDNKHLNLLSSDSEIEQDYQKAKKRKTSDLNQEHGNGSAILGKLSVKTPIKNTNRKPVSMDNFNDSLTSSGTENDPFVPNIRHNPKELGTANGTGHSTPLSKLKVSASFADKLPQKEVPSTILVPEVEQQEPSQSERTPSLFSSEGSGSESEAPLLPEITTPGPHQPMGNTSNNVVEMIDTDSSNLVSDEDEVLVPTRIETPQLPTEKDVEKCEARVQELQEEVNEQLEHENGSEFDVKQGSGKVGNRHKFKRALKFLSKSLLALFLFCIFIVIPLLFGLWYREQRLLIGYCGHEVPSHRVSGNSFEFIQKLDNLLQDYRPKCIPCPPNGICYPYLKLKCKPDYKLAPSRLDFLEIIPAQGKCVKDDKKQQLVSEVVEKSLEFLRAKNAQISCGDGKDDIESGMTEDALYQIFNEARAPWIRDDEFEDLWIQVIKDLTEEPEILWRQLSPTDNNIGGNSNNIIKTNDVPRQKRHLPEKFISKTRNFRSTSKKYIGMKCRFEREIYQTYKKFQRPIWLMFLLIVISKVIEIKLKNYYRKKARIEELVTQTMEKLKFQKIKSMSDPKENAYLSIVQLRDIFLSDIVDLKYKNQLWSEVVKYLEHNNSNIKSNLTEIRGEIMKCWEWIGPMELNEPKDSAENKI 214CA064ECE160F4 nupl_xenla Nucleoplasmin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASTVSNTSKLEKPVSLIWGCELNEQDKTFEFKVEDDEEKCEHQLALRTVCLGDKAKDEFNIVEIVTQEEGAEKSVPIATLKPSILPMATMVGIELTPPVTFRLKAGSGPLYISGQHVAMEEDYSWAEEEDEGEAEGEEEEEEEEDQESPPKAVKRPAATKKAGQAKKKKLDKEDESSEEDSPTKKGKGAGRGRKPAAKK Nucleoplasmin is an acidic protein which is able to assemble nucleosomes by binding histones and transferring them to DNA mint heh2-kap60-2 3279510 N/A 3279523 unspecified role unspecified role unspecified role unspecified role Region 100-137 Region 100-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false heh1-kap60-1 3279511 N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279525 unspecified role unspecified role unspecified role unspecified role Region 171-221 Region 171-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kap60-heh1-1 3279512 N/A 3279524 unspecified role unspecified role bait bait Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3279525 unspecified role unspecified role prey prey Region 171-221 Region 171-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03707:p.[Arg176Ala;Lys190Ala] R176A/K190A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q03707:p.Arg176Ala R176A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false heh2-kap60-3 3279513 N/A 3279523 unspecified role unspecified role bait bait Region 100-137 Region 100-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role prey prey Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false heh1-kap60-2 3279514 N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279525 unspecified role unspecified role unspecified role unspecified role Region 171-221 Region 171-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kap60-nupl_xenla-1 3279515 N/A 3279526 unspecified role unspecified role unspecified role unspecified role Region 151-172 Region 151-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false heh1-kap60-3 3279516 N/A 3279524 unspecified role unspecified role prey prey Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279525 unspecified role unspecified role bait bait Region 171-221 Region 171-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false heh1-kap60-4 3279517 N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279525 unspecified role unspecified role unspecified role unspecified role Region 171-221 Region 171-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03707:p.[Arg176Ala;Lys190Ala] R176A/K190A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q03707:p.Arg176Ala R176A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q03707:p.Lys190Ala K190A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kap60-nupl_xenla-2 3279518 N/A 3279526 unspecified role unspecified role prey prey Region 151-172 Region 151-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role bait bait Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false heh2-kap60-4 3279519 N/A 3279523 unspecified role unspecified role bait bait Region 97-137 Region 97-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role prey prey Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false heh2-kap60-5 3279520 N/A 3279523 unspecified role unspecified role unspecified role unspecified role Region 100-137 Region 100-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false heh2-kap60-6 3279521 N/A 3279523 unspecified role unspecified role unspecified role unspecified role Region 97-137 Region 97-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03281:p.[Arg103Ala;Lys126Ala] K126A/R103A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q03281:p.Arg103Ala R103A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q03281:p.Lys126Ala K126A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role unspecified role unspecified role Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kap60-heh2-1 3279522 N/A 3279523 unspecified role unspecified role prey prey Region 97-137 Region 97-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03281:p.[Arg103Ala;Lys126Ala] K126A/R103A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q03281:p.Arg103Ala R103A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3279524 unspecified role unspecified role bait bait Region 88-530 Region 88-530 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false