DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ xu-2015-22 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266045X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-23 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266054X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-24 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266050X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-25 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266046X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-26 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266055X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-27 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266051X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-28 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266058X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-29 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266047X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-30 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266052X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-31 human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266048X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-32 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266056X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-33 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266059X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-34 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266049X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-35 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266057X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-36 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266060X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation xu-2015-37 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. DIP original experiment: DIP-266053X Nature structural & molecular biology 2015 IMEx Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Xu H., Gustafson CL., Sammons PJ., Khan SK., Parsley NC., Ramanathan C., Lee HW., Liu AC., Partch CL. Only protein-protein interactions imex curation clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ q9wtl8-4 Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Arnt3 Brain and muscle ARNT-like 1 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL bmal2_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 2 Arntl2 Bmal2 Brain and muscle ARNT-like 2 protein protein mouse Mus musculus Mouse MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRRRDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQDKELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKVKEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSSCSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKSGKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLSLLHCGGSSQSSEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASPSEEVRDDCSVNGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWAL cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN ep300_mouse Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 Ep300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein mouse Mus musculus Mouse MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL arntl-clock-14 3278817 N/A 3278833 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3278834 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl2-cry1-1 3278818 N/A 3278835 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 471-505 Region 471-505 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Rho-label Rho-label tetramethyl rhodamine label tetramethyl rhodamine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false arntl-ep300-1 3278819 N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278837 unspecified role unspecified role unspecified role unspecified role Region 565-653 Region 565-653 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false clock-arntl-10 3278820 N/A 3278833 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3278834 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false arntl-crebbp-2 3278821 N/A 3278838 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arntl-cry1-1 3278822 N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9WTL8-4:p.Val602_Ile603delinsAlaPhe V603A/I604F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arntl-crebbp-3 3278823 N/A 3278838 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arntl2-clock-4 3278824 N/A 3278835 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3278833 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false arntl-cry1-2 3278825 N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 471-505 Region 471-505 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Rho-label Rho-label tetramethyl rhodamine label tetramethyl rhodamine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9WTL8-4:p.[Leu606Ala;Leu607Ala] L606A/L607A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false clock-arntl2-2 3278826 N/A 3278835 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3278833 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arntl2-crebbp-1 3278827 N/A 3278835 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278838 unspecified role unspecified role unspecified role unspecified role Region 586-665 Region 586-665 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arntl2-cry1-2 3278828 N/A 3278835 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false arntl-cry1-3 3278829 N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3278834 unspecified role unspecified role unspecified role unspecified role Region 579-626 Region 579-626 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cry1-arntl-7 3278830 N/A 3278834 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3278833 unspecified role unspecified role prey prey O08785:p.[Gln361Pro;Trp362Arg] Q361P/W362R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3278836 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false arntl2-ep300-1 3278831 N/A 3278835 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278837 unspecified role unspecified role unspecified role unspecified role Region 565-653 Region 565-653 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arntl2-cry1-3 3278832 N/A 3278835 unspecified role unspecified role unspecified role unspecified role Region 540-579 Region 540-579 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278836 unspecified role unspecified role unspecified role unspecified role Region 470-503 Region 470-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false