DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lisa-2015-1 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. DIP original experiment: DIP-265769X Structure (London, England : 1993) 2015 IMEx Molecular Basis of the Activity and the Regulation of the Eukaryotic-like S/T Protein Kinase PknG from Mycobacterium tuberculosis. Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. Only protein-protein interactions imex curation lisa-2015-2 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. DIP original experiment: DIP-265767X Structure (London, England : 1993) 2015 IMEx Molecular Basis of the Activity and the Regulation of the Eukaryotic-like S/T Protein Kinase PknG from Mycobacterium tuberculosis. Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. Only protein-protein interactions imex curation lisa-2015-3 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. DIP original experiment: DIP-265768X Structure (London, England : 1993) 2015 IMEx Molecular Basis of the Activity and the Regulation of the Eukaryotic-like S/T Protein Kinase PknG from Mycobacterium tuberculosis. Lisa MN., Gil M., André-Leroux G., Barilone N., Durán R., Biondi RM., Alzari PM. Only protein-protein interactions imex curation pkng_myctu Serine/threonine-protein kinase PknG MTCY22G10.06c Rv0410c pknG protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF gara_myctu Glycogen accumulation regulator GarA MTCY1A11.16c Rv1827 garA protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDMNPDIEKDQTSDEVTVETTSVFRADFLSELDAPAQAGTESAVSGVEGLPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPKQGEDDGSTGGP pkng-3 3278706 N/A 3278709 putative self putative self unspecified role unspecified role Region 1-405 Region 1-405 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false gara-pkng-1 3278707 N/A 3278710 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 44-162 Region 44-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278709 enzyme enzyme unspecified role unspecified role Region 138-750 Region 138-750 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1-405 Region 1-405 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false gara-pkng-4 3278708 N/A 3278710 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 14-30 Region 14-30 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3278709 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false