DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wei-2015-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. DIP original experiment: DIP-266172X Nature cell biology 2015 IMEx Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. Only protein-protein interactions imex curation wei-2015-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. DIP original experiment: DIP-266175X Nature cell biology 2015 IMEx Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. Only protein-protein interactions imex curation wei-2015-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. DIP original experiment: DIP-266173X Nature cell biology 2015 IMEx Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. Only protein-protein interactions imex curation wei-2015-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. DIP original experiment: DIP-266174X Nature cell biology 2015 IMEx Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Wei SC., Fattet L., Tsai JH., Guo Y., Pai VH., Majeski HE., Chen AC., Sah RL., Taylor SS., Engler AJ., Yang J. Only protein-protein interactions imex curation g3bp2_human Ras GTPase-activating protein-binding protein 2 GAP SH3 domain-binding protein 2 G3BP2 KIAA0660 protein protein human Homo sapiens Human MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKSTTPPPAEPVSLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGTGQMEGRFTGQRR twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH twst1_mouse Twist-related protein 1 Twist1 Twist M-twist protein protein mouse Mus musculus Mouse MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH twist1-g3bp2-1 3278266 N/A 3278270 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3278271 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false twist1-g3bp2-2 3278267 N/A 3278272 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3278270 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false twist1-g3bp2-3 3278268 N/A 3278270 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3278271 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false twist1-g3bp2-4 3278269 N/A 3278272 unspecified role unspecified role bait bait Region 105-112 Region 105-112 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P26687:p.Tyr107Glu Y107E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3278270 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false